(data stored in ACNUC9435 zone)

EMBL: CP002400.PE501

CP002400.PE501       Location/Qualifiers
FT   CDS_pept        complement(538858..539295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26092"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:E6U928"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4217"
FT                   /protein_id="ADU26092.1"
FT                   /translation="MNITKQQIKSIYALGAGLHIVGRGHDDELHALVDGLTGKESITAL
FT                   DRDEAQRVIAELMRRMRGTPPVPPARKKPRHYEEAPGGITADQQRKVWALMYELKKIRR
FT                   QAGGRCPWRPAVRDHPAAIRHGLHRKKADAVSGPGRGRRTD"
     gtgaacatta caaagcagca gatcaaatcc atctatgccc tgggcgcggg gctgcatatc        60
     gtggggcgcg gccacgacga tgagctgcac gcgttggtgg atggcctgac gggcaaagaa       120
     tccattacgg cgcttgatcg ggacgaagcc cagcgcgtga ttgcggaact gatgcggcgg       180
     atgcgcggca caccgccggt gcctccggcc cgaaaaaagc ccaggcatta cgaagaagcg       240
     cccggcggta tcaccgccga ccagcagcgc aaggtgtggg cgctgatgta cgagctgaaa       300
     aaaattcgac gtcaagccgg tggacgctgc ccttggagac cggctgtgcg ggatcatccg       360
     gcggcaattc ggcatggact gcaccgcaaa aaagccgatg cagtttctgg accaggccgc       420
     gggcggcgaa ctgattga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page