(data stored in ACNUC9435 zone)

EMBL: CP002400.PE502

CP002400.PE502       Location/Qualifiers
FT   CDS_pept        complement(539326..539991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_4388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26093"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z3"
FT                   /inference="similar to AA sequence:KEGG:Amet_4388"
FT                   /protein_id="ADU26093.1"
FT                   /translation="MMENEPLFSTEETVLRVGRLVALKAQESKIKAEIGDLQGYFERLG
FT                   IDALENTKEKTVAWWSAAGRVEVGTSEKVDILSETALKTLLQGVFGDLFKEQPVTYQPT
FT                   AACKQLLAAIAAGNYLEGSLDDIVARVADDDKTNKTLRKKLCGNFKRDKKALIDVAGLS
FT                   KTDAEEYAYMAAEIVAYTRFRQLLQAAGYTGTFEAARDIVKAAVVVEEGTKVTVEASK"
     atgatggaga atgaacctct tttctccacg gaggaaacgg tgctgcgggt gggcagactg        60
     gttgccctga aagcgcagga aagcaaaatc aaggccgaga tcggcgacct gcaaggttat       120
     tttgaacgcc tgggcatcga cgccctggag aacaccaagg aaaagaccgt ggcgtggtgg       180
     agcgcagccg gacgcgtgga ggtgggcaca agcgaaaagg tggacattct ttcggaaacg       240
     gctcttaaaa cacttttaca gggcgttttc ggggatttgt tcaaggagca gcccgtgacc       300
     tatcagccca ccgccgcctg caagcagctg ctggccgcca tcgccgcggg aaactatctg       360
     gaggggtcgc tggacgatat cgttgcgcgg gtggccgatg acgataaaac gaacaaaacc       420
     ctgcgcaaaa agctgtgcgg caacttcaaa cgcgacaaaa aggccctgat tgatgtggcc       480
     gggctttcga aaacggacgc cgaggaatac gcctacatgg cggcggagat cgtggcctat       540
     acgcgctttc ggcagctatt gcaggcggcc ggatacacag ggacatttga ggccgcgcgc       600
     gatatcgtga aagcagccgt ggtcgtcgag gaaggcacca aagtgaccgt ggaggcttca       660
     aaatag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page