(data stored in ACNUC9435 zone)

EMBL: CP002400.PE507

CP002400.PE507       Location/Qualifiers
FT   CDS_pept        complement(541576..541863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g211222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26098"
FT                   /db_xref="InterPro:IPR024522"
FT                   /db_xref="UniProtKB/TrEMBL:E6U934"
FT                   /inference="similar to AA sequence:KEGG:NEMVE_v1g211222"
FT                   /protein_id="ADU26098.1"
FT                   /translation="MGLFILGSFFGASAGVTVMCLLQIGKRKGDETLGLWYLSAVESAV
FT                   FLEQLHQADTRDLRIAKAALGSYKAQGYHVADRYQAVKKELNKRMAYGRR"
     atgggattat ttattctcgg cagttttttc ggcgcgtccg ccggcgtgac ggtgatgtgc        60
     ctgctgcaaa ttggaaaacg aaaaggagat gaaactttgg ggttgtggta tttgtcggcg       120
     gtcgaaagcg ccgtgtttct ggagcagctt caccaggcgg acacgcgcga cttgcgtatt       180
     gccaaagccg cgctgggttc ttacaaggcg cagggatacc atgtggcaga ccggtatcag       240
     gcggtaaaaa aagagctgaa caagcgcatg gcatacggga ggagatga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page