(data stored in ACNUC9435 zone)

EMBL: CP002400.PE511

CP002400.PE511       Location/Qualifiers
FT   CDS_pept        complement(545722..546063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppe:PEPE_1019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26102"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:E6U938"
FT                   /inference="similar to AA sequence:KEGG:PEPE_1019"
FT                   /protein_id="ADU26102.1"
FT                   /translation="MDKQEEQTVIGRVIAYLNEKTGARYRAEAAANRRHVLARLADGFS
FT                   EQDLLDVIDGMSAAWADSDFARYLRPETLFRSQGKTESYLQEARRRQKKKAAPAATGRF
FT                   RSASDLLED"
     atggataaac aggaagaaca gaccgtgatc gggcgggtga ttgcgtacct gaatgaaaaa        60
     acaggcgcgc gttaccgggc agaagcagcg gcgaacagac gccatgtgct ggcacgtctg       120
     gcagacggtt ttagcgagca ggatctgctg gacgtgatcg acggtatgtc ggccgcatgg       180
     gcggattccg acttcgcgcg atatcttcgg ccagagacgc tctttcgttc gcagggaaag       240
     accgaaagct atttgcaaga agcacgccgc aggcaaaaga agaaagccgc tccggcggct       300
     accgggcggt ttcggtcggc ctccgactta ctggaggact ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page