(data stored in ACNUC9435 zone)

EMBL: CP002400.PE512

CP002400.PE512       Location/Qualifiers
FT   CDS_pept        complement(546080..546259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26103"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU26103.1"
FT                   /translation="MQIAKTRARGTPTKPVTVRYELGVYDSIKKYADENSMSIALATES
FT                   LVIKGLKRASRQAS"
     atgcaaattg cgaagacccg agcgcgtggc acgccgacga agcccgttac cgtgcggtac        60
     gagctggggg tatacgattc catcaaaaaa tatgcggacg agaacagcat gtccatcgcg       120
     ctggcgacgg aaagcctggt catcaagggc ctcaaacggg ccagccgcca agcatcgtaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page