(data stored in ACNUC9435 zone)

EMBL: CP002400.PE533

CP002400.PE533       Location/Qualifiers
FT   CDS_pept        565622..566494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0546"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bmd:BMD_1434 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26124"
FT                   /db_xref="GOA:E6U9D3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU26124.1"
FT                   /translation="MISLEQIQYFLAIVRYGSLNKASEHLYISQPSLSKQLQHLEKELG
FT                   CKLLIRNYDGIEATSPGKLFYEQMSGILEEFDRAIDKVRHFDEVRQLRVGGLGNLVTYF
FT                   LPRYIERLKAGGRNQVTVDTRFSNEELVKGVESGKFDLVLLSNAEPQQNLAVIPLMTEP
FT                   LYVVFPVAHPLRCQQSISFMEIVLHEKLVLYKDPCTIRASIRRQCNRMKVTPNIVLELD
FT                   LTESLLRYVSHGDGITLLPSIVAKGIQDPSIATREISRIPIYREISVAMKKENVPSYLP
FT                   MFSENIKAF"
     atgatcagcc tcgagcaaat acaatatttt cttgcaatcg tccgttacgg cagcttgaac        60
     aaagcatccg agcaccttta catttcgcag ccgtcgcttt cgaaacagct gcaacatctt       120
     gaaaaggagc ttggctgcaa actgttgatc cgaaactatg acggcattga agcgacctct       180
     cctggaaagc tgttctatga gcaaatgagc ggcattttgg aagaatttga tcgggcaatc       240
     gataaagtca gacattttga tgaggtgcgt caactgcgcg tcggcggact tggaaatctg       300
     gtgacctatt ttctcccccg gtatatagaa cggctgaaag caggcgggcg gaatcaggtg       360
     accgttgata cccgcttctc caacgaggaa cttgtaaaag gggtcgaaag tggaaaattc       420
     gacttggtac tgctttccaa cgcggagccg cagcagaatc ttgccgtgat cccgctcatg       480
     acggagccgc tctatgtggt gtttcctgtt gcccaccctc tgcgctgcca acagagcatt       540
     agttttatgg agatcgtcct gcatgaaaaa ctggtgctct ataaggatcc ctgcaccatc       600
     cgcgcctcga tacgcaggca gtgcaaccgc atgaaagtga cgccgaatat cgtgctggag       660
     ctggacctga cagagtcgct cttgcgctac gtgagccatg gagacggcat cacccttctg       720
     ccctcgatcg tggcaaaagg gattcaggac ccttccatcg ccacacgaga aatcagccgc       780
     attccgatct accgggaaat atccgtcgcc atgaaaaagg aaaatgtacc ctcctatctg       840
     cccatgtttt ccgagaacat taaggcattc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page