(data stored in ACNUC9435 zone)

EMBL: CP002400.PE54

CP002400.PE54        Location/Qualifiers
FT   CDS_pept        62518..64056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0054"
FT                   /product="transposase IS605 OrfB"
FT                   /note="PFAM: transposase IS605 OrfB; KEGG: cce:Ccel_2298
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25645"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H8"
FT                   /inference="protein motif:PFAM:PF07282"
FT                   /protein_id="ADU25645.1"
FT                   /translation="MPCYKTLSLEIREPGRRKRELMDTALLSYTRALEQLLRQCREPVQ
FT                   ALARGGRRVTRAQVQALADKDMLRALNVYGVQPFKDSLKQDFATILLSFAARWQKSGGQ
FT                   AGYPCVRLEPEEADARIRALTDAYDAGMLSAAEMRGRLAVVLAHSGRVHPLYFGRYAAA
FT                   RDYCLLYDPGTGRFFAKLHLLNAKSRLPPAPFGRELRVVAPGLPSAQATDGPRRFIVVP
FT                   LSFGKAQQEVLRQALDHPQILRTARLVRHGDAYRLVLSVEVSCNACVVPQATMGVARAA
FT                   AALACTVCGRDGAVQGNAMLSARGGQMLFCLAKEITARALEARAQVVLEANGGRGDGFL
FT                   LRDGGRFQPEVFPAGQYMRLEHILRYKLVEAGLPPPVCVSGSGLNITCPRCGAVTRKNR
FT                   LSPQMFACVACGYAAPFPFVGSRNLAVRLQKYAGNKVPVYVREENGMRHYFNDALGFSC
FT                   TVPAEDGETVVFYELSLMAKGRQEDWCEGKKYAMLCKLRAAEDIRNAVRWVPVK"
     atgccctgct acaaaacgct ttcgttggag atccgtgagc ctgggcggcg gaaacgggaa        60
     ctgatggata ccgccctgct gtcctatacc cgcgcgttgg agcaactgct gcggcagtgc       120
     cgggagccgg tgcaggcgct ggcccggggc ggccggcgcg tcacgcgtgc gcaggtgcag       180
     gcgctggcgg acaaggatat gctgcgtgca ctcaatgttt acggtgtgca gcccttcaag       240
     gactcgctca agcaggattt tgccactatt ttgctcagtt ttgccgcgcg ctggcagaag       300
     tcgggcggcc aggcgggcta tccctgtgtc cgcctggagc cggaggaggc ggatgcgcgg       360
     atccgcgccc tgacggacgc ttacgatgcg ggaatgcttt cggccgcaga gatgcgcggg       420
     cggctggcgg ttgtgcttgc gcacagtggg cgggtgcatc cgctctattt cgggcggtat       480
     gccgccgcgc gggactattg cctgctctat gatcccggta ccgggcgttt tttcgccaag       540
     ctgcacctgc tcaatgccaa aagccgtttg ccgccggcgc ctttcgggcg cgaactgcgc       600
     gtagtggcgc ccggtcttcc gtctgctcag gcaacggacg gcccccggcg gttcatcgtg       660
     gtgccgctgt cgttcggcaa agcgcagcag gaggtgctgc ggcaggctct ggaccatccg       720
     cagattctcc gcacggcaag gctggtgcgg cacggcgacg cataccgtct ggtgctgagc       780
     gtggaggtat cctgcaatgc gtgcgtggtg ccgcaggcga cgatgggcgt ggcgcgagca       840
     gccgcggcgc tggcctgcac ggtgtgcggc agggatggcg ccgtgcaggg aaacgccatg       900
     ctctccgcga gaggcgggca gatgctgttc tgcctggcga aggagatcac tgcgcgcgca       960
     ttggaggcac gcgcacaggt ggtgctggaa gcaaacggcg gtcggggcga cggctttctc      1020
     ctgcgggatg gcggccgttt ccagccggag gtgttccctg ccgggcaata tatgcggctg      1080
     gagcatatcc tgcggtataa actcgtggaa gcggggctgc ctccgcctgt atgtgtcagc      1140
     ggcagcggct tgaacatcac ctgcccccgc tgtggggcgg ttacccgaaa aaaccgtctt      1200
     tccccgcaga tgttcgcctg tgttgcctgt ggatacgcag cgccctttcc gttcgtgggc      1260
     agccgcaacc ttgccgtccg gctgcagaaa tacgcgggca acaaggtgcc cgtgtatgtg      1320
     cgggaggaaa acggcatgcg gcactatttc aacgacgcgc tgggtttttc ctgcacggtg      1380
     cccgccgagg acggagagac cgtggtgttt tacgagttga gcctgatggc gaaaggccgg      1440
     caggaggact ggtgcgaagg caaaaaatac gccatgctct gcaaactgcg cgcggcggag      1500
     gatatccgca atgcggtgcg ctgggtgccg gtgaaatga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page