(data stored in ACNUC9435 zone)

EMBL: CP002400.PE549

CP002400.PE549       Location/Qualifiers
FT   CDS_pept        594826..595836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0563"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vex:VEA_000665 spermidine putrescine transport
FT                   ATP-binding protein PotA; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26140"
FT                   /db_xref="GOA:E6U9E9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26140.1"
FT                   /translation="MSYIALESIEKRFGKQHVLKNIHLELGKGEFASLLGPSGCGKSTL
FT                   LRCIAGLETVTSGSICIDGIDVTGRSPKERAVGMVFQQYSLFPNMTVEQNIGFGLKMMH
FT                   VPKQEIRERVRAMLDTVALTGSEKKKPAQLSGGMQQRVALARALITRPKVLLLDEPLSA
FT                   IDAKLRKDLQTEIRRIQKETNITTVFVTHDQSEAMLMSDTIHIMHEGVIEQSGCPSDIY
FT                   VAPKTPFAAGFIGNYNLLSAAAFQKLTAAEIEGENVAIRPEVIGISKEKPDCDEDTICA
FT                   QGVVVESLLHGNILSYQVRCGDCILKTDVLYRTVDRFENNAPVWLCFSGKDFVAL"
     atgagttata ttgcgctgga atcgatcgaa aaacgatttg gtaaacagca tgtgctgaaa        60
     aacatccatc tggaactggg aaaaggggag tttgcatcgc tgctggggcc gtcgggctgc       120
     ggcaaaagca cgttgctgcg ctgtatcgcc gggctggaaa cagttacgtc cggtagcatc       180
     tgcatcgacg gtatagacgt gaccggccgc tcaccaaaag agcgcgcggt cggcatggtg       240
     ttccagcaat acagtctttt ccccaatatg acagtggagc aaaacattgg gttcgggctg       300
     aagatgatgc atgtgcctaa acaggagata cgtgagcgag tgcgggcgat gcttgatacc       360
     gtggcgctta cgggcagtga gaagaaaaaa ccggcgcagc tgtcgggcgg tatgcaacag       420
     cgtgtagcgc ttgcccgtgc gcttatcacc aggcccaagg tgctgctgct ggacgaaccg       480
     ctcagtgcca tcgacgccaa gctgcgcaag gatctgcaga cggagatccg gcgcatccag       540
     aaagaaacca atatcaccac ggtctttgtc acacacgacc aaagtgaagc gatgctgatg       600
     tccgacacca tccacatcat gcacgagggt gtgatcgagc agtccggctg cccaagcgac       660
     atttatgtcg cgcccaaaac gccgtttgcc gccggattta tcggcaacta caatctgctg       720
     agcgccgccg catttcaaaa actgactgcc gcagagatcg aaggagaaaa cgtggccatt       780
     cggccggagg tcatcggcat ctcgaaagaa aagccggatt gcgacgagga tacgatttgt       840
     gcgcagggcg tggtggtgga gtcgcttctg catgggaata tcttgtctta tcaagtgcgg       900
     tgcggcgact gcatcctgaa aacggatgtg ctctaccgca cggtggaccg ttttgaaaac       960
     aacgcaccgg tctggctttg tttcagcggg aaggactttg tggcgctttg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page