(data stored in ACNUC9435 zone)

EMBL: CP002400.PE554

CP002400.PE554       Location/Qualifiers
FT   CDS_pept        complement(598638..600053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0568"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="KEGG: lrl:LC705_00323 PTS system fructose-specific
FT                   transporter subunit IIC; TIGRFAM: PTS system, fructose
FT                   subfamily, IIC subunit; PTS system, fructose-specific, IIB
FT                   subunnit; PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26145"
FT                   /db_xref="GOA:E6U9F4"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F4"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADU26145.1"
FT                   /translation="MKIIGVTKCPTGIAHTYMAAEKLARAAKELSYDAKIETQGASGTE
FT                   NKLTDADIKEADYVIIAADVTIDGKERFAGKKLLELPIKPVIKDPVGILKSLETEAKVY
FT                   AEKSVDSPAKSNAAGGSAVIKQLMNGVSHMIPFVVIGGLFIATSLAFGGHATSSGLVIS
FT                   SPFWQKVNAIGGISFNYLMYPILAGFIAFAISGRAALAPAMVCALVANDKTILGTNAGM
FT                   GFLGAILVGYLAGYLVKWFNSWKVPKSIQPIMPIFVIPILGIGIISAALILVLGAPISW
FT                   LMTALQHVLKLLSLNPSTSIVLGLLLGAMVGVDMGGPINKVAFLFGVASITSGNPQIMG
FT                   AVACAIPVPPLSMGLATLIGKKYFDEDEQTAGIPALLMGLIGITEGAIPFASADPKRAL
FT                   PSVIIGSSIAGAVGMLFGITDVVPHGGPIIGILGATNNIALFFLTIAAGSVIAALLAVF
FT                   LKSRYFKAQAKGE"
     atgaaaatta tcggcgtaac aaaatgtcct accggcatcg cgcacaccta tatggcggcc        60
     gagaagctgg cccgcgccgc caaagaacta agctatgatg caaaaattga aacacagggc       120
     gcaagcggaa cggaaaacaa actgaccgat gccgacatca aggaggcgga ttatgtcatc       180
     atagccgctg atgtaaccat tgatgggaaa gaacgttttg ccggcaagaa actgcttgaa       240
     cttcccatca aaccggttat caaagatccg gtgggtattc tcaaatccct ggaaaccgaa       300
     gcgaaagttt atgcggaaaa aagcgtagac agcccagcga aatcgaatgc agcaggcggc       360
     agcgccgtaa tcaagcaact gatgaacggt gtttctcaca tgattccgtt cgtagtaatc       420
     gggggtctgt tcatcgcaac atcgcttgct ttcggaggcc atgcgacgtc aagcgggctt       480
     gtcatatcca gtcctttctg gcaaaaagtc aacgcgatcg gcggtatttc atttaattac       540
     ctgatgtatc cgatcctggc cggctttatc gcttttgcca tatccggacg tgcggctctc       600
     gctccggcaa tggtttgcgc cctggtcgca aatgataaaa ccatcctcgg aacaaacgcc       660
     ggcatgggat ttttaggcgc catccttgtc ggttatctgg cagggtacct tgtaaaatgg       720
     ttcaactcct ggaaggtgcc caaaagcatc cagccaatca tgcccatttt tgtcattccc       780
     attttgggca tcgggatcat ttccgcagcc ctgattttgg ttttgggcgc tcctatttcc       840
     tggctgatga ccgctcttca gcatgtattg aaactacttt cgctcaatcc cagcacaagc       900
     atcgtgcttg gcctgttgct tggcgcgatg gttggcgtgg atatgggcgg tcctatcaac       960
     aaagtggcgt ttctgtttgg cgtagcctcc atcacatccg gcaacccgca aatcatgggg      1020
     gctgtggcgt gcgccattcc cgttccgcct ctttcgatgg gccttgccac gctgatcggg      1080
     aaaaaatatt tcgatgagga cgaacaaacc gcaggcatcc cggcgctgct catgggcctg      1140
     atcggtataa ccgagggggc tatccccttt gcgtctgccg accccaaacg tgcgctgcca      1200
     agcgtcatca tcgggagcag catcgccggt gcagtcggca tgctttttgg catcaccgac      1260
     gttgtgccgc acggcggacc gatcatcggc atccttggcg ccacgaacaa catcgcgctg      1320
     tttttcctga cgattgccgc aggaagcgta attgccgcat tgctggccgt tttcctgaaa      1380
     agcagatatt ttaaagctca ggccaaagga gaataa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page