(data stored in ACNUC9435 zone)

EMBL: CP002400.PE561

CP002400.PE561       Location/Qualifiers
FT   CDS_pept        606396..606764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0575"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: amt:Amet_1467 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26152"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G1"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADU26152.1"
FT                   /translation="MKIAVACDGKNVSGHFGHCEGFELFTEDGGNITECKFYQNPGHKP
FT                   GFLPNYLNDLGTNTIIAGGIGGGAIEIFNEKNIEVIAGARGDAAEAVEQYLKGQLKSTG
FT                   SVCHEHEFESTCEEHDQH"
     atgaaaattg cagtagcgtg tgatggcaaa aatgtttccg ggcattttgg acattgcgaa        60
     ggattcgaac tgtttacaga agatggaggt aacattaccg aatgcaaatt ctatcagaat       120
     ccgggtcata agccgggttt ccttcctaat tatttaaacg atctcggcac caataccatt       180
     attgccggag gcatcggtgg gggcgccatc gaaattttta acgaaaaaaa catcgaagtg       240
     attgcgggtg cccggggcga tgcagcagag gcggttgaac agtatttgaa aggccagttg       300
     aaatcgaccg gcagcgtctg tcacgagcat gagtttgaaa gcacctgtga agaacacgac       360
     cagcattga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page