(data stored in ACNUC9435 zone)

EMBL: CP002400.PE562

CP002400.PE562       Location/Qualifiers
FT   CDS_pept        606860..607705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0576"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: hor:Hore_18400 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26153"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G2"
FT                   /inference="similar to AA sequence:KEGG:Hore_18400"
FT                   /protein_id="ADU26153.1"
FT                   /translation="MLDFQILTDNIVNRPHLLAEHGLSLWIRDDDKQILFDTGQTSVFL
FT                   QNALSLGIPIQNADAIVLSHGHYDHCGGVVSYPFGDSKTKLYIGSNAFETKLSVKGGAI
FT                   RNIGIPWGRAFFDRVGDRIVEIKNGDEIFTGIHVLGGIARYNDYEKVSECFYTERDGQK
FT                   SRDTMEDEQLLVMERKDRLAVFSGCSHKGVINCVEHVRTKFPGKRIHTLVAGMHLQGVS
FT                   KERLDATIEYFVNSEIERIIPLHCTGIEPICELKRALQDRCLICAVGDRIVIDEGTRWV
FT                   "
     atgctcgact ttcaaattct cacggataat atcgtgaacc gtccgcatct gcttgcagag        60
     cacggtttgt ccttgtggat cagggatgat gataaacaaa ttctttttga caccggccaa       120
     acgtcggttt ttctgcaaaa tgccttatcc ctgggtatac cgatacagaa cgcggatgcc       180
     attgtattaa gccacgggca ttacgatcat tgcggtggag tggtcagcta tccgtttgga       240
     gacagtaaaa caaaactgta tatcgggtcc aatgcctttg aaacgaagct ttcggtaaag       300
     ggcggcgcca tccgaaatat tggaataccc tggggacgcg cgttttttga cagagtggga       360
     gatcggatag ttgaaataaa aaatggtgat gagatattca ctggaatcca cgtgcttggg       420
     ggaatcgccc ggtataacga ttatgaaaag gtgtccgaat gcttttacac ggagagggac       480
     ggccagaaga gcagagacac gatggaggat gaacaactgc tggtgatgga aagaaaagac       540
     cgcttggcgg tcttttcggg ttgcagccac aaaggcgtca tcaactgtgt ggagcatgtg       600
     cgaacaaaat ttcctggaaa aagaatacat actctggttg cgggcatgca tttgcaaggc       660
     gtcagtaaag aaagattgga tgccaccatc gagtattttg taaattctga aatagaacgc       720
     ataataccgt tgcattgcac gggaatagaa ccgatctgtg aactgaaaag ggcgctgcag       780
     gatcggtgcc tgatttgcgc ggttggcgac cgcatcgtca tagatgaagg aacaagatgg       840
     gtttga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page