(data stored in ACNUC9435 zone)

EMBL: CP002400.PE571

CP002400.PE571       Location/Qualifiers
FT   CDS_pept        616272..617138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0585"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cbe:Cbei_4939
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26162"
FT                   /db_xref="GOA:E6U9H1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU26162.1"
FT                   /translation="MGKPSKRTDAGQIAVMVGPVTLWLAFLVAVPLVYVFIMSFCSLDQ
FT                   NYNVVFRFTLENYRRLLDWDYIQVYGQSILIAFLATAICIVLAYPFAFLIARTFQSKKT
FT                   TLYMMVIIPFWTNSLIRIYGWRTFLGANGMLNKLLMALHMTGGPVQFLFTRGATVLGMV
FT                   YVLFPFMVLPLYTAIEKLDQSQLEASADLGARGGSTFWHVILPQTTSGVFSGCIMVFIP
FT                   CLGYFYVSDILGGGNTNVIGNLIERQFQSGNNWPLGAALSIILIAITLLLVKLYQKCGG
FT                   DMQSLGV"
     atgggaaagc caagcaaacg gacggatgcg ggacagattg ccgttatggt cggtccggtt        60
     accttgtggc tggcgttttt ggtggcggtt ccgcttgttt atgtgtttat tatgagtttt       120
     tgcagcctag accagaatta caatgtggtt ttccgtttta cactggaaaa ctatcggcgg       180
     cttttggact gggactacat acaggtttac gggcagtcta ttttgattgc atttctggca       240
     accgctattt gcattgtgtt ggcttacccg tttgcctttt tgattgcccg gacttttcag       300
     agcaaaaaga cgaccttata tatgatggtg attattccgt tctggacgaa ttccttgatt       360
     cgcatttacg gctggcgcac ctttctgggc gcgaacggga tgctcaacaa actgctgatg       420
     gcgctgcata tgaccggtgg gccggtgcag tttctgttca cccgcggggc aacggtgctg       480
     ggtatggtgt atgtcctgtt cccgtttatg gtactgccgc tgtacacggc gatcgaaaaa       540
     ctggaccagt cgcagcttga ggcgtcggct gatcttggcg cgcgcggagg ctccacattc       600
     tggcatgtga ttctgccgca gacgacgagc ggcgtgtttt cgggctgcat catggtcttt       660
     attccgtgtc tcggttattt ctatgtatcc gatattctgg gcggcggcaa cacgaacgtc       720
     atcggcaacc tgattgagcg gcagttccag agcggaaaca actggccttt aggcgcggcg       780
     ctgtccatta tcctgattgc gatcaccctg ctgctggtca agctgtacca gaagtgtggc       840
     ggcgatatgc agagtttggg ggtgtaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page