(data stored in ACNUC9435 zone)

EMBL: CP002400.PE573

CP002400.PE573       Location/Qualifiers
FT   CDS_pept        619409..620761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0587"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   cbe:Cbei_4934 putrescine--2-oxoglutarate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26164"
FT                   /db_xref="GOA:E6U9H3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H3"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADU26164.1"
FT                   /translation="MSYADVSKDLERVIGYIHADKLTDEEKETMTRETLHYFDEYVSPG
FT                   WLKYRKSVSTNSAVLEWTDRDSVLDGMNGEEFIDCLGGFGIYTCGHRNPEILDTVKAQL
FT                   DHQALHSQELLDPLRGYLAKAVADITPGDLGKCFFTNGGAEAVEMSLKLARIATGGRWF
FT                   VSTVSAFHGKSMGAISVGGKNTFRIPYTPMVQQVVHVEYGNAEDTRKAVRNLQAVGEKV
FT                   AAVIVEPIQGEAGVIVPPEGYLKELRAVCDECGVALIFDEIQTGMGRTGTMWRCEVENV
FT                   TPDILIFGKAFGGGIMPITGLICRPPMWTQQLIDNPWLLGSPTFGGNPVCCSAALATIK
FT                   FMIDHDIPGQAKRKGAVLKAGLQKLKEKYPAVIVDVRGEGLMLAVEFEKSEIGYSIAKG
FT                   MFARGVLTAGTLNNSKTVRFEPPAVITEEQIEKVLARMDEALAETEREFAR"
     atgagttatg cagacgtgag caaggatctg gagcgggtga tcggctacat acacgccgac        60
     aaactgacgg atgaagaaaa agaaacaatg acaagggaaa cgctccatta tttcgatgaa       120
     tatgtgagtc caggctggct caaataccgc aaatccgttt ccaccaattc tgccgtgctg       180
     gaatggacgg atcgcgattc tgtgcttgac ggcatgaacg gtgaggagtt cattgactgt       240
     ctgggcggat tcggcatcta cacctgcggc caccgcaacc ctgaaattct cgatacggtg       300
     aaggcgcagc tggaccatca ggcgctgcat tcgcaggaac tgctggatcc gctgcgcggt       360
     tatctggcga aggctgtggc ggacatcacg cccggcgatc tgggaaagtg cttctttacc       420
     aacggcggtg ccgaagcggt ggagatgtcg ctgaaactgg cacgaatcgc caccggcgga       480
     cgctggtttg tctccacggt cagcgcgttt cacggcaaga gcatgggtgc catctcggtg       540
     ggcggcaaaa acacattccg cattccctat acgccgatgg tgcagcaggt cgtgcatgtg       600
     gaatatggca atgcggaaga tacgcgcaaa gctgtgcgca atctgcaggc ggtcggtgaa       660
     aaagtcgctg ccgtcattgt ggagcccatt cagggcgagg cgggtgtcat tgtgccgccc       720
     gaagggtatc tgaaagaact gcgcgccgtg tgtgatgaat gcggtgtcgc actgattttt       780
     gacgagattc agaccggtat ggggcgtacc ggcaccatgt ggcgctgtga agtggaaaac       840
     gtcacccccg atatcctgat ctttggcaaa gcgttcggcg gtggcatcat gccgattacc       900
     ggccttatct gccgtccgcc catgtggacg cagcaactga tcgacaaccc gtggctgttg       960
     ggctccccga ccttcggcgg caacccggtg tgctgttctg cggctcttgc caccatcaag      1020
     tttatgatcg accatgacat cccgggacag gcaaagcgaa aaggcgccgt actgaaggca      1080
     gggctgcaga agctgaaaga gaagtatccc gccgtcatcg tggacgtgcg cggcgaaggt      1140
     ctgatgctgg cggtcgaatt tgagaagagt gaaatcggct acagcattgc aaagggcatg      1200
     ttcgcgcgcg gtgttctgac agccggcacg ctgaacaaca gcaaaacggt ccggtttgag      1260
     ccgccggccg tcatcacgga agagcagatc gaaaaggtgc tggcccgcat ggatgaggcc      1320
     ctggccgaaa cagaacggga gtttgcgcgt taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page