(data stored in ACNUC9435 zone)

EMBL: CP002400.PE575

CP002400.PE575       Location/Qualifiers
FT   CDS_pept        621412..622161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0589"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bmq:BMQ_pBM70141 DNA-binding response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26166"
FT                   /db_xref="GOA:E6U9H5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU26166.1"
FT                   /translation="MSYEKRPICSGRITGIFKKGMAMQNRILIADDDREIVEVMDDALR
FT                   DEGFETVRAYNGKQVLEQLSGEKPIDLFILDIMMPEMDGLETLRHIRERTDAPVLILSA
FT                   RGREIDKVIGLRVGADDYVSKPFSVDELMARVGAHLRRENKHRQSAPVTGIGALKLDPS
FT                   SWTVEVDGKPVELSGKEFQILSYLLINAGQTVSREQIYAAVWKDAFGGDLSTVTVHIKN
FT                   LRDKLGAEGRRIRTVWGIGYRLERDLP"
     atgtcatatg agaagcgccc gatctgttcg ggccggataa ccggcatatt taaaaagggg        60
     atggccatgc aaaaccggat tctgatagca gacgatgaca gggaaatcgt cgaggtgatg       120
     gatgatgcac tgcgggacga aggatttgaa accgtccgtg cctataatgg aaagcaggtt       180
     ttggaacaac tgtccggaga aaaaccgatt gacctgttta ttctggacat catgatgccg       240
     gaaatggacg gactggaaac gcttcgtcat atcagggaac ggacggatgc ccccgtgctt       300
     atcctcagcg cccgcggccg ggagatagac aaggtgatcg gcctgcgtgt tggagcggac       360
     gactatgtct caaaaccgtt ttccgtcgat gagttgatgg cccgggtggg tgcgcatctg       420
     aggcgggaaa acaagcacag acagtccgcg ccggtcaccg gcatcggcgc tctgaagctc       480
     gatccgtcca gttggacggt ggaggtggat ggcaagccgg tggaactgtc cggcaaggaa       540
     tttcagattt tatcgtatct gctgatcaac gccgggcaga ccgtttcgcg cgagcaaatc       600
     tatgcagctg tctggaaaga cgcattcggc ggcgatttaa gtaccgtaac ggtccacatc       660
     aaaaatctgc gcgacaaact gggagcggag gggcgccgca ttcgcaccgt ctggggcatc       720
     ggttatcgtc tggagcgtga cctcccatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page