(data stored in ACNUC9435 zone)

EMBL: CP002400.PE577

CP002400.PE577       Location/Qualifiers
FT   CDS_pept        623575..624282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0591"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cpy:Cphy_2590 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26168"
FT                   /db_xref="GOA:E6U9H7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26168.1"
FT                   /translation="MSEPIIQFEHITKQYHMGEVVIDALRGVDFTINKGEFAIVAGPSG
FT                   AGKSTVLNILGGMDTPTDGHLLVDGQDISRFDRKQLIAYRRKAIGFVFQFYNLVPNLTA
FT                   LENVELAVEICDHPFSPRKVLEQVGLEDRMQNFPAQLSGGQQQRVAIARALAKNPTLLL
FT                   CDEPTGALDSGTGRAVLKLLQDTCRRTGMTVVLITHNLAIAPMGDRLIHIKNGVVERME
FT                   TNPHPKTVDEIAW"
     atgtccgaac ccatcatcca atttgagcat atcaccaaac aataccacat gggtgaagtc        60
     gtcattgatg cactgcgcgg agtcgatttt acgatcaaca agggggagtt cgccatcgtg       120
     gccgggccga gcggcgcagg gaaaagcacg gttctcaata ttctcggcgg gatggatacg       180
     cctaccgacg gccacctgct ggtcgatggg caggatatca gccgctttga ccgcaaacag       240
     ctcatcgcct atcgccgcaa ggccatcggg tttgtgttcc agttctataa tctggtgccc       300
     aacctgacgg cgcttgaaaa cgtagagctt gcggtcgaga tctgcgacca cccgttttct       360
     cccaggaaag tgctggagca ggtggggctg gaagaccgca tgcagaactt tccggcacag       420
     ctttccggcg ggcagcagca acgcgtggcc atcgcgcggg cgcttgccaa aaaccctacc       480
     ctgctgttgt gcgacgagcc gaccggcgca ctcgattccg gaaccgggcg tgcggttttg       540
     aagctgctgc aggacacttg ccgccgcacc gggatgacgg tcgtgctcat cacgcacaat       600
     ctggcgatcg cacccatggg cgaccggctc atccacatca aaaacggcgt ggtcgagcgc       660
     atggaaacca atccgcatcc caaaaccgtg gatgagattg cgtggtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page