(data stored in ACNUC9435 zone)

EMBL: CP002400.PE60

CP002400.PE60        Location/Qualifiers
FT   CDS_pept        complement(68860..69834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0060"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: ere:EUBREC_0699 putative lipid kinase; PFAM:
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25651"
FT                   /db_xref="GOA:E6U5I4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I4"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADU25651.1"
FT                   /translation="MLSERTGKNILFILNPNAGKQHIGRKSDELVTLFEESGCRVDART
FT                   TTRPGDAAELAEQLASAYDLVVCCGGDGTLHEVVNGMLRASAQVPLGYLPTGTTNDMAR
FT                   TLRLPGDVRKAAGVVLQGHTAAQDLGLFNGTQYFSYIASFGAFTSIPYSTPQWLKNLLG
FT                   YPAYLLQVLRCLPEMHPYALEMETNDGLHAKGRFLFGSVSNARSVSGIFRFKPEDVSLD
FT                   DGLFELMLIRHPENPLEFFRIAHNLIRRKADDHFVIFRHVRTVSFRFETETSWTVDGEY
FT                   GGTTRSVEIRTLHRALPFISGRPQRIRARRSRFSHSRSPHLTP"
     atgttatcag aacgcacagg gaaaaatatt ctgtttatcc tcaaccccaa cgccggcaaa        60
     cagcatatcg gccgcaagtc ggacgagctg gtcacacttt ttgaagaaag cggctgccgc       120
     gtggacgcgc ggacaaccac ccgccccggc gacgcagcgg aactggccga acaacttgca       180
     tccgcctacg atctggtggt ctgctgcggc ggcgacggca cactgcacga agtcgttaac       240
     ggaatgctgc gcgcgtctgc acaggtgccg ctgggatatc tgcccaccgg caccaccaac       300
     gacatggccc gcaccctgcg cctgccgggc gacgtgcgca aagccgcagg cgtggtgctg       360
     cagggtcata ccgccgcgca ggatctcggc ctgttcaacg gcacgcagta tttctcctat       420
     atcgcgtcgt tcggcgcttt caccagcatc ccgtattcca cgccccaatg gctgaaaaac       480
     ctgctgggct atcccgccta tctgcttcaa gtgctgcggt gcctgccgga gatgcacccg       540
     tatgcgctgg aaatggaaac gaatgacggc ctgcatgcaa aagggcgctt cctgtttgga       600
     agcgtgagca acgcccgctc cgtatcgggt attttccggt tcaaacccga agatgtctcc       660
     ctggacgatg gcctgttcga gttgatgctc atccgtcatc ccgaaaatcc actggaattt       720
     ttccgcatcg cgcacaacct catccgccgc aaagcggacg atcatttcgt tattttccgg       780
     catgtgcgga cggtatcgtt ccggtttgaa accgaaacct cctggacagt ggacggcgaa       840
     tacggcggaa ccacccgctc ggtggagatc cgcacgctgc accgcgcgct gccgttcatt       900
     tcaggccgtc ctcagcgcat acgcgcgcgg cgcagccggt tttcacacag ccggtcgccg       960
     catctcactc catga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page