(data stored in ACNUC9435 zone)

EMBL: CP002400.PE67

CP002400.PE67        Location/Qualifiers
FT   CDS_pept        81439..82014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0068"
FT                   /product="HymD protein"
FT                   /note="KEGG: cpo:COPRO5265_0171 HymD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25658"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J1"
FT                   /inference="similar to AA sequence:KEGG:COPRO5265_0171"
FT                   /protein_id="ADU25658.1"
FT                   /translation="MPEMKKKRNSIFWVAQAGLLIALLVVVQLLTFLMPKSVPLIGQLF
FT                   TGTLVNLVLIVGAGSVGFAGTAAAAVLSPVLAFAFGQMVFPPMIPVVAIGNLVIVAVTW
FT                   AVFVHETRRPPKNSSVFRMAGIVCGAAAKTAFLWLATVLLVVPVLFGGKPAVAQVLSLM
FT                   FSWPQLVTAMVGGALALVVLRFIQGYQE"
     atgccggaga tgaaaaagaa gcggaacagc attttctggg tggcgcaggc ggggctgctc        60
     atcgcgctgc tggtcgttgt gcagttgctg acgtttttga tgccgaaatc cgtgccgctg       120
     atcgggcaat tgttcaccgg cacattggta aacctggtgc ttatcgtggg ggcgggatcg       180
     gttgggtttg ccggcacggc ggctgcggca gtgctgtcgc ctgtgctggc gtttgcgttt       240
     ggtcaaatgg tttttccgcc gatgatcccg gtcgtggcca tcggcaatct ggtgatcgtt       300
     gccgtcacct gggcggtttt tgtgcatgag acccgccggc ccccaaaaaa cagttcggtg       360
     ttccgcatgg ccggcattgt ctgcggtgcg gcggcaaaga cggccttttt atggctggct       420
     accgttttgc tggttgttcc ggtgcttttt ggcggtaaac cggcggtcgc gcaggtcctg       480
     tcgctcatgt tttcctggcc gcagctcgtc acggcaatgg tcggcggtgc tttggcgctg       540
     gtagttctgc ggttcataca ggggtatcag gaataa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page