(data stored in ACNUC9435 zone)

EMBL: CP002400.PE69

CP002400.PE69        Location/Qualifiers
FT   CDS_pept        complement(83105..83521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0070"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   clj:CLJU_c31730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25660"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J3"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADU25660.1"
FT                   /translation="MTPLEYFLQKAADNGISVYELSLENIQSMIADLKDMDPAICLSSS
FT                   GIFSSQEAAESMAHELGHFFTGTYYDSPYCANNRGKMEHQANIWMVKELLPVASIRKAL
FT                   KDGCREYWEIAEYCNCTEHLLETAIQIYRQKGLL"
     gtgacgcccc ttgaatattt tcttcaaaaa gcagccgata atggaatttc tgtttatgaa        60
     ttatctcttg agaacatcca gtccatgatt gcggatttaa aagacatgga ccctgctatt       120
     tgtctgagtt cttctggaat tttctcatct caggaagccg ccgaatcgat ggcacatgaa       180
     ctcggtcatt tctttacggg tacatattat gattcaccct attgcgccaa taatcgtggc       240
     aaaatggagc atcaggccaa tatttggatg gtgaaagaat tgcttccggt tgcgtccatt       300
     cggaaagctc taaaagacgg ttgccgcgaa tattgggaga ttgcggagta ctgcaattgt       360
     accgaacatc tgttggaaac ggccattcag atttaccggc agaaagggct gctatag          417
//

If you have problems or comments...

PBIL Back to PBIL home page