(data stored in ACNUC9435 zone)

EMBL: CP002400.PE74

CP002400.PE74        Location/Qualifiers
FT   CDS_pept        85554..87506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0075"
FT                   /product="Transposase-like Mu"
FT                   /note="PFAM: Transposase-like Mu ; Integrase catalytic
FT                   region; KEGG: dae:Dtox_4214 transposase-like Mu"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25665"
FT                   /db_xref="GOA:E6U5J8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J8"
FT                   /inference="protein motif:PFAM:PF09299"
FT                   /protein_id="ADU25665.1"
FT                   /translation="MLTVAQVAQVKGCTERYVRTMIAKGKLEHVLDDDPRNHMRQYLVP
FT                   VAALPEKLQAKYYGRVAPTKTAAIAAPQEPPKPLDAYSEEERREIELWIGIVQEWKTYR
FT                   IGRDRKAADGAFVAQMRQRHPELSISTDVLYRRWKAWRDQHYDGLIDRRGKWRKGRYAM
FT                   DETVWECFLSYWFDLRKYPMKQCIHYTQLWCEQEHPELLAGIPSYSAFYRRWKAEIPEA
FT                   LNVLGREGDKVFDDRCGPYLPRIYDDMASNDFWIADNHTFDIISEGENGTRHRLYLTAF
FT                   MDARSGIITGFHITDNPSSEATIYALRAGILQYGIPKYIYVDNGREFLTYDVGGLGHRR
FT                   KKKSADTFSPPPIFARLGITMINAQVRNARAKIIERRFLDFKNQISRLFMTFTGGNVLE
FT                   KPANLKHVLKAGHVPADHRLREVVGQLLEGYFNEQPYNGSVAADKGKNRKDVYYDHLEE
FT                   KRVASADDLTLMLMRSTRLQKVGRMGVHLTIGGFRIDYRDDAFCLRYQGEQVYVRYDPE
FT                   NISSVRVYDEQDRFIAVLQANSNIISGYVTSKEVAKESISKIKSAKKLARQEIKSRVLA
FT                   SMDQVDALDLVLGDAQRNIAARMENGEPDRSVLQIHRVSEEPLMPPRVVNGALPLDTML
FT                   KNAENAQRASQHKDI"
     atgctgacag tggcgcaggt ggcgcaggtc aaagggtgta cggaacgtta cgtgcgtacg        60
     atgattgcca aaggcaaact ggagcatgtg ctggacgacg acccgcgcaa ccatatgcga       120
     caatatctag tgccggtggc cgcgcttccg gaaaaactgc aggccaaata ctacggacgg       180
     gtggcaccca caaaaaccgc agccattgcc gcgccacagg agcctcccaa gccgctggat       240
     gcttacagcg aggaggagcg ccgggagatt gagctgtgga ttgggatcgt gcaggaatgg       300
     aagacctacc gcatcgggcg cgaccgaaaa gccgccgacg gggcctttgt ggcacagatg       360
     cggcagcggc acccggaact gtctatctcg acggacgtgc tgtaccgccg ctggaaggca       420
     tggcgcgacc agcattatga cggactgatc gaccggcgcg gaaagtggcg caaaggacgg       480
     tacgcgatgg atgaaacggt gtgggaatgc ttcctgtcct actggttcga cctgcgcaag       540
     tacccaatga agcaatgcat ccactacaca cagctctggt gtgagcagga acacccggaa       600
     ttgctggccg ggatcccatc ctacagcgct ttttaccggc gctggaaggc cgagataccg       660
     gaggcgctca atgtgctggg tcgcgagggc gacaaggtat ttgacgaccg atgcgggccg       720
     tatctacccc gcatctacga cgacatggca tccaatgatt tctggattgc ggacaaccac       780
     accttcgaca tcatcagcga gggggaaaac gggacaaggc atcgcctgta cctcacagca       840
     ttcatggacg cgcgctccgg catcatcaca gggttccata tcacggataa cccatccagc       900
     gaagccacaa tttacgcgct gcgcgcgggc atcctgcaat atggcattcc aaagtatatc       960
     tatgtagata acggccgcga gttccttaca tacgacgttg ggggcctcgg gcaccgccgg      1020
     aaaaagaaaa gcgcggatac tttttcgccg ccgccgattt tcgccaggct tggcattacg      1080
     atgatcaacg cgcaggtgcg gaatgcgcgg gcgaagatca tcgaacgccg gttccttgat      1140
     ttcaagaacc aaatcagccg actatttatg acgttcacgg gcgggaacgt gcttgaaaag      1200
     cccgcaaatc tgaaacatgt gctgaaagcc gggcatgtgc ctgcggatca ccggctgcgc      1260
     gaggttgtgg ggcaactgct ggaaggatac ttcaacgagc agccttacaa cggctccgtc      1320
     gcggcggaca aaggcaaaaa ccggaaggac gtttactacg accatctgga agaaaaacgc      1380
     gtggcctccg ccgacgactt gacgctgatg ctgatgcgca gcacgcgctt gcaaaaggtt      1440
     ggccgaatgg gcgtgcatct gacgattggc gggttccgca ttgactaccg ggacgacgcg      1500
     ttttgcctgc gttaccaagg cgagcaggtt tatgtgcgct acgacccgga aaacatcagt      1560
     tccgtgcgcg tctacgatga gcaggaccgg tttatcgccg tccttcaggc gaacagcaac      1620
     atcatatccg gctatgttac cagcaaggaa gttgcgaaag aatccatcag caaaatcaag      1680
     tccgccaaga agctggcccg gcaggagatc aagtcccgcg tactggcctc tatggatcag      1740
     gtggacgcgc tggatctggt gctgggtgac gcgcagcgga atattgccgc ccgaatggaa      1800
     aatggggaac ctgaccgctc ggtactgcag atccaccgcg tgagcgagga accgctgatg      1860
     ccgccgcgtg tggtgaacgg cgcattgccg ctggacacca tgctgaaaaa tgccgaaaac      1920
     gcccaaaggg cgtctcaaca taaggacatc tga                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page