(data stored in ACNUC9435 zone)

EMBL: CP002400.PE75

CP002400.PE75        Location/Qualifiers
FT   CDS_pept        87522..88472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0076"
FT                   /product="putative ATPase, transposase-like protein"
FT                   /note="KEGG: dae:Dtox_4216 putative ATPase,
FT                   transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25666"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4216"
FT                   /protein_id="ADU25666.1"
FT                   /translation="MAQTYDVKLQARVEELIKQCGSQAKASRILGWSDGVISQYRRSDY
FT                   ERGRVDEVEASLREYFRLQDEAAAQAQRAEPFQPVLDTYIPISVSEDIRKAIRFGQLKK
FT                   GITILHGDAGIGKTMAAEKYLRDNPNTAVLITVTPLTGTVGNVMKLICRALHIPEGRSK
FT                   LDMIIDLKERLYNTDKVLIIDEAQHLQVRALDEIRPLSEPHIDGKKGIGIVLIGNSEIY
FT                   DRMEGRRQSCFAQLYSRKRLTRKYTTKQVTPEDIALLFPALEGKKRELNFLRGICQGRY
FT                   GIRGGVNVYNNAVDAENIGIDMLTLQAREMGIGLN"
     atggcacaaa catacgatgt aaaattacag gctcgcgtag aggaactgat caagcagtgc        60
     ggtagccaag ccaaagcatc ccgtatcctt ggatggagcg acggcgtcat cagccaatac       120
     cgtcgcagcg attatgagcg cggacgtgtg gatgaggtgg aagccagcct gagggagtat       180
     ttccggctgc aggacgaggc ggccgcccag gcgcaacgcg ctgaaccatt tcagcccgtg       240
     ctggacacct acataccgat cagcgtcagc gaggacatcc gcaaggcaat ccgctttggg       300
     cagttgaaaa aaggcatcac catcctgcac ggtgacgcgg gcatcgggaa gacgatggcg       360
     gccgaaaaat atttgcggga caaccccaac accgccgtgc tgatcaccgt gacccctctc       420
     accggcaccg taggaaacgt gatgaagctg atctgccggg cgctgcatat ccccgagggg       480
     cgcagcaagc tggatatgat catcgacctg aaggaacgcc tgtacaatac ggacaaagtc       540
     ctcatcatcg acgaagccca gcatttgcag gtgcgggcgc tggacgagat tcggcccctt       600
     tccgagccgc acattgatgg gaaaaaaggc atcggcatcg tgctgatcgg aaactccgaa       660
     atctacgacc ggatggaagg acgcaggcaa tcgtgctttg cgcagctcta ttcccgcaag       720
     cggctcaccc gaaaatacac caccaaacag gtaacaccgg aagatatcgc gctgttgttt       780
     cccgcgctgg aagggaaaaa acgagagttg aactttttgc gcggcatctg ccagggccgt       840
     tacggaatcc gcggcggcgt aaatgtgtac aacaatgcgg ttgacgcgga aaacattgga       900
     atcgacatgc tgacgctgca ggcccgggaa atgggcatcg gcctgaactg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page