(data stored in ACNUC9435 zone)

EMBL: CP002400.PE77

CP002400.PE77        Location/Qualifiers
FT   CDS_pept        88681..89157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2988 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25668"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y9"
FT                   /inference="similar to AA sequence:KEGG:MA2988"
FT                   /protein_id="ADU25668.1"
FT                   /translation="MDFVSAVKEMWNCGSTCVSLPIGNERKIVIRPRPFPKMMEKAVFG
FT                   RDKRLSEVYQGASLTLNELLANDWEVFDPAEFALAGAAPAKMDKLLELPAALSGAKKIT
FT                   SVEAAVRKLSDEELYTAADVYEERVAQGKREKTRLRFVLEEIRHRERKRGQAHA"
     atggattttg tgtccgcagt gaaggaaatg tggaattgcg gctccacttg tgtgagcttg        60
     ccgatcggga atgaacgaaa aatcgtgatc cgcccgcggc ctttccccaa aatgatggaa       120
     aaggccgtgt tcgggcggga caaacgcctt tcagaggtat atcagggcgc cagcctgaca       180
     ttaaatgagc tgcttgcaaa cgactgggag gtatttgacc cggcggaatt tgctcttgct       240
     ggcgcggctc cggcaaaaat ggacaaatta ctggaactgc cggcggcgct gtccggggca       300
     aaaaaaatca cgtcggtgga agcggctgta cggaaactga gcgatgagga actgtacact       360
     gccgcggatg tatatgagga gcgtgtggct cagggtaaga gagaaaagac gaggctgcgg       420
     tttgtgctgg aggaaatccg gcaccgggaa agaaagagag ggcaggcaca tgcgtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page