(data stored in ACNUC9435 zone)

EMBL: CP002400.PE83

CP002400.PE83        Location/Qualifiers
FT   CDS_pept        91454..91777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0084"
FT                   /product="Mor transcription activator domain protein"
FT                   /note="PFAM: Mor transcription activator domain protein;
FT                   KEGG: amt:Amet_4373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25674"
FT                   /db_xref="GOA:E6U5Z5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z5"
FT                   /inference="protein motif:PFAM:PF08765"
FT                   /protein_id="ADU25674.1"
FT                   /translation="MNLERVTLEDLDGDQRELAELIGMEAYRALATHHGGTYVYVQAPN
FT                   SLLRKDRNEQIRRKFDGKNYKELALEYQISESTVRLIVEDDARRMRYGPISGQINLFDK
FT                   KMF"
     atgaatctgg aacgtgttac actggaggat ctggacggcg accagcgcga actcgcggag        60
     ctgatcggca tggaagccta tcgggcactg gccacacacc acggcggaac ctatgtgtat       120
     gtgcaggccc cgaacagcct gcttcgcaaa gaccgcaacg agcagatccg ccggaaattc       180
     gacggaaaaa actataaaga gctggcgctg gagtatcaaa tttcggaaag caccgttcgc       240
     ttgatcgtag aggatgacgc cagacggatg cggtatggcc ccatttccgg gcaaatcaac       300
     ctgtttgata aaaaaatgtt ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page