(data stored in ACNUC9435 zone)

EMBL: CP002400.PE9

CP002400.PE9         Location/Qualifiers
FT   CDS_pept        10002..10151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25600"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D3"
FT                   /inference="similar to AA sequence:KEGG:Geob_0432"
FT                   /protein_id="ADU25600.1"
FT                   /translation="MFWAIIAVLFILWLLGVLLAHVFGGLIHLLLILLIVLVIVKIIRN
FT                   IRRL"
     atgttttggg cgattatcgc ggttttgttt atcctctggc tgttgggtgt ccttctggcg        60
     catgtgttcg gcgggctgat tcatctgctg ctcatcctgc tgattgtgct ggtcatcgtg       120
     aagatcatac ggaacatacg cagactatga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page