(data stored in ACNUC9435 zone)

EMBL: CP002400.PE90

CP002400.PE90        Location/Qualifiers
FT   CDS_pept        96805..98472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0091"
FT                   /product="minor capsid 2 protein"
FT                   /note="PFAM: minor capsid 2 protein; KEGG: ere:EUBREC_1286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25681"
FT                   /db_xref="GOA:E6U602"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:E6U602"
FT                   /inference="protein motif:PFAM:PF06152"
FT                   /protein_id="ADU25681.1"
FT                   /translation="MLTPEWFDGAADDILELYGQLDESILQDFVRRIIKSGGILTQTAR
FT                   WQAQSLQDGGMLYEDIIRAVASMTSASTAQVRTLFEDGGVEALKYDFSIYEAAGLSPLP
FT                   LKQSPVAAQVLRAGMQKTAGHLRNLTMTTAAGTEQAYKNAARLAEMQVESGAFDYISAI
FT                   RNAVRTAAQSGTTVLYPSGHTDDLDVAVRRAVLTGMSQTAAQVSLRYADDMGCDLVETT
FT                   AHPGARWSHAIWQGRVFCRNGKRGKYPDFVSSTGYGSGDGLCGWNCRHSFFPYFEGLST
FT                   PAYPHTKLAEYAQKTVTYNGDTMTYYAATQKQRAMERAIRATKRELAGYYTGLQAEDEG
FT                   IRNAMREEYTKTSVKLKGQEARLADFTDKAGVDRQREREQSLGFGRGPAQQARQSAEKH
FT                   YRKWAQGIGADDAAPKTLAKYYQEKYNNSPAHELLAGYNKAVKRGDVSPLVGFEQYTRT
FT                   AKDADAQIVGVTTANGVKIESYTTHFIDRLIGQTSTPHTGMRTGVSIADAKDALVRPMQ
FT                   ISNPYAAEDGDLRQQFFGENASVVISLRDKKVIQTNPL"
     atgctgacgc ctgaatggtt cgacggcgcg gcggacgaca ttctggagct gtacggacag        60
     ttggatgaat ccatcctgca ggactttgtg cggcgcatca tcaaatccgg cggcattctc       120
     acacagacgg cccgctggca ggcgcaaagc ctgcaggacg gcggcatgct gtatgaagac       180
     atcatccgcg cggtggcgtc catgacgagc gccagcacag cacaagtgcg cacactgttt       240
     gaagacggcg gcgtggaggc gttgaaatat gacttttcta tctatgaggc cgccggtctt       300
     tcgccgctgc cgctcaagca atcgcccgtt gccgcgcagg tgctgcgggc cgggatgcaa       360
     aagaccgccg gacatctgcg caacctgacc atgacgacgg cggccggcac agagcaggcg       420
     tacaagaatg ccgcccggct ggcggaaatg caggtggaat ccggtgcatt tgattacata       480
     tccgctatcc gaaacgccgt gcggacggcc gcacagtcag gcacaaccgt actgtatcca       540
     tccgggcaca cggacgattt agacgtggcc gtgcggcggg cggtcctgac cggtatgagc       600
     cagacagcgg ctcaggtatc tctgcggtat gctgacgata tgggctgcga cctcgtggag       660
     accaccgcgc atccgggcgc gcggtggtcg catgccatct ggcaggggcg ggtattttgc       720
     cgcaatggaa aacgcggcaa atatcccgat tttgtatcgt ccaccgggta tggctcgggc       780
     gacggcctgt gcggctggaa ctgccgacac agcttttttc cttacttcga ggggttgagc       840
     acgccagcct atccccacac caagctggcc gaatacgccc aaaaaaccgt gacgtacaac       900
     ggcgacacga tgacctatta cgccgccaca cagaagcagc gcgccatgga gcgcgccatc       960
     cgcgcgacca aacgggagct ggccggatat tacaccggcc tgcaggccga ggacgaaggc      1020
     atccggaacg cgatgcgtga agaatatacc aaaacgtccg taaaattgaa agggcaggaa      1080
     gcccggctgg cggatttcac cgacaaggcg ggggtggatc gccagcggga acgcgaacag      1140
     tcgcttggct ttgggcgcgg accggcgcag caggcgcgcc aatctgccga aaagcattac      1200
     cgaaaatggg cacaaggaat cggcgcggac gacgccgcac cgaaaacgct tgcaaaatac      1260
     taccaggaga agtataataa ctctcctgcc cacgagctgc tggcgggtta caataaggca      1320
     gtgaagcgag gagatgtctc cccgctggtg ggatttgaac aatacaccag gacggcaaag      1380
     gacgccgatg cccagattgt cggcgtcacc acggccaacg gcgttaagat cgaatcgtat      1440
     accacgcatt tcattgaccg gctgatcggg cagacctcca cgccgcacac cggcatgcgc      1500
     acgggcgtgt ccattgcgga cgcgaaagat gcgctggtgc gcccgatgca gataagcaac      1560
     ccgtatgcgg ccgaggacgg cgacctgcga cagcaattct ttggagaaaa tgcttcggtg      1620
     gtcatcagcc tgcgggataa aaaggtgatc cagaccaatc cgctgtaa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page