(data stored in ACNUC1104 zone)

EMBL: CP002417.PE1

CP002417.PE1         Location/Qualifiers
FT   CDS_pept        88..1467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   vap:Vapar_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34224"
FT                   /db_xref="GOA:E6UWL9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6UWL9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU34224.1"
FT                   /translation="MSTDGIGESLWQACVDQLAQELSEQQFNTWIKPLTAQVADDLSRM
FT                   TVFVANRFKLDWIRAQYAGKIAAMAEKMYGQPVAVELALAPREAPVRSAPIAVMTETDV
FT                   PRDVAGPGEEPAAAGFKNRLNSGLTFDTLVEGTANRMARAAAMHVAGMPGHLYNPLFIY
FT                   GGVGLGKTHLMHAVGNRLLADRPDSKVLYIHAEQFVSDVVKAYQRKTFDEFKERYHSLD
FT                   LLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLADIHERLVSRFDSG
FT                   LTVAIEPPELEMRVAILINKARAESAEMPEEVAFFVAKNVRSNVRELEGALRKILAYSR
FT                   FNQKEISIALAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKKRPASIARPR
FT                   QIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKISGERQQLTELNQQLHVLEQTLK
FT                   G"
     atgtcgactg acggcatcgg cgaaagcctc tggcaggcct gcgtcgacca gctcgcgcag        60
     gagctgtccg agcagcagtt caacacctgg atcaagcccc tgaccgcaca ggttgccgac       120
     gacctgtcgc gcatgacggt gttcgtggca aaccgcttca agctcgactg gatccgcgcc       180
     cagtacgccg gcaagatcgc cgccatggcc gagaagatgt acggccagcc ggtggccgtc       240
     gagttagcgc ttgctcctcg cgaagcaccc gtccgctctg cgcccatcgc cgtgatgacc       300
     gagaccgatg tgccgcgtga cgtggccggt ccgggcgaag agcctgccgc tgccggcttc       360
     aagaaccgcc tgaattcagg cctcactttc gacacccttg tcgaaggcac ggccaaccgc       420
     atggcgcgcg ccgccgcgat gcacgtggcc ggcatgccgg gtcacctgta caacccgctt       480
     ttcatctacg gcggcgtcgg cctgggcaag acccacttga tgcacgctgt gggcaaccgg       540
     ctgctggccg atcgccccga ttccaaagtt ctctacatcc acgccgagca attcgtctcg       600
     gatgtggtca aggcctatca gcgcaagact ttcgatgagt tcaaggagcg gtatcactcg       660
     ctcgacctgt tgctgatcga cgatgtgcag ttcttcgcca acaaggaccg cacgcaggaa       720
     gaattcttca acgcgttcga ggccctgctc gccaagaagt cgcacatcgt gatgaccagc       780
     gacacctacc ccaagggcct ggccgacatc cacgagcgac tggtttcacg cttcgattcc       840
     ggcctcacgg tggccatcga gccgcccgag ctcgagatgc gcgtggccat tcttatcaac       900
     aaggcgcgcg ccgaatcggc cgagatgccg gaagaggtcg ctttcttcgt tgccaagaac       960
     gtgcgctcca acgtgcgcga gctcgaaggg gcgctgcgca agatcctggc ttactcgcgc      1020
     ttcaaccaga aggagatctc gatcgccctg gcacgcgagg cgctgcgcga cctgctgtcg      1080
     atccagaacc ggcagatctc ggtcgagaat atccagaaga cggtggccga ctactacaag      1140
     atcaaggtcg ccgacatgta cagcaagaaa cgcccggcca gcattgcgcg gccgcggcag      1200
     atcgcgatgt acctggccaa ggagctcacg caaaaaagcc tgccggaaat cggcgagctg      1260
     ttcggcgggc gcgaccacac gacggtgctg cacgcggtgc gcaagatctc gggcgagcgc      1320
     cagcagctca ccgagctcaa ccagcagctg cacgtcctcg aacagacgct caagggctga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page