(data stored in ACNUC1104 zone)

EMBL: CP002417.PE10

CP002417.PE10        Location/Qualifiers
FT   CDS_pept        10594..11169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0010"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="PFAM: Lipid A 3-O-deacylase-related; KEGG:
FT                   vap:Vapar_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34233"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN9"
FT                   /inference="protein motif:PFAM:PF09411"
FT                   /protein_id="ADU34233.1"
FT                   /translation="MKSHPCAPLRAAVFAGLFGLLGTAAHAFGDDTRGFYLDGGHARHG
FT                   EKGDTNSVSVGMTVPWSFNERRPGSPFSSYLDFYISNWHARPLDDGPRNFVQIGAIYTL
FT                   RYRFGDGASPWFAEGGVGATLMDHVYRTPDRSFSTAFQFTEVLGIGRSFGDNGAHEVSL
FT                   RVQHVSNGGIKKPNPGETFLRLRYTYHF"
     atgaaatcac atccttgcgc gccccttcgg gccgccgtgt tcgcaggcct tttcggcttg        60
     ctgggcacgg cggcccatgc ttttggcgac gacacccgcg gcttctacct cgacggcggc       120
     catgcgcgcc acggagagaa gggcgacacc aactcggtca gcgtcggcat gacggtgccg       180
     tggtcgttca acgagaggcg accgggaagt ccgttctcct cgtacctcga cttctacata       240
     agcaactggc atgcgcgtcc cttggacgac ggcccgcgca atttcgtcca gatcggcgcg       300
     atctacacct tgcgctaccg cttcggcgac ggcgcgtcgc cctggttcgc cgaaggcggc       360
     gtcggcgcga ccttgatgga ccatgtctac cgcacgcccg accgcagctt cagcacggcc       420
     ttccagttca ccgaggtgct aggcatcggg cgcagcttcg gcgacaacgg agcgcatgaa       480
     gtctcgctgc gggtgcaaca cgtttcgaat ggcggcatca agaagcccaa cccgggcgag       540
     accttcctgc gcctgcgcta cacctatcac ttctag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page