(data stored in ACNUC1104 zone)

EMBL: CP002417.PE100

CP002417.PE100       Location/Qualifiers
FT   CDS_pept        complement(100659..101474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0101"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_0088 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34323"
FT                   /db_xref="GOA:E6UYZ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU34323.1"
FT                   /translation="MSSSQTDFATIAWRGRAVQIECAWIASERTDAPLIVFLHEGLGSV
FT                   AMWKDFPAQICEAANARGLVFSRPAYGRSTPREDNEIWDVDFMHRQAHEVLPALFAALK
FT                   LDHEKPWLFGHSDGGSISLLYASRFPERVSGLVVLAPHIFVEDVTVANIELARTAYLST
FT                   DLPKKLARYHDSADSAFWGWNRIWLHPPFRDWNIEAELDAIRCPVLAIQGIDDEYGTLA
FT                   QIRGIAARVGGGCELVEIPECGHSPHRDQPERVTVATASFITKNRRQTP"
     atgagcagca gccagaccga cttcgccacc atcgcctggc gcggccgcgc cgtgcagatc        60
     gagtgcgcgt ggatcgcctc tgagcgcacc gacgcgccgc tcatcgtctt cctgcacgag       120
     ggcctcggct ccgtcgcgat gtggaaggat ttccccgcgc aaatctgcga ggcggccaac       180
     gcccgcggcc tcgtgttctc gcgccccgcc tacggccgct ccacgccgcg cgaagacaac       240
     gagatctggg acgtcgactt catgcaccgc caggcgcacg aagtgctgcc cgccctcttc       300
     gccgccttga agctcgacca cgaaaagccc tggctcttcg gccacagcga cggcggttcg       360
     atctcgctgc tgtatgcctc gcgcttcccc gagcgtgtgt cgggccttgt cgtactggcc       420
     ccgcacatct tcgtggaaga cgtgacggtc gcgaacatcg agctggcccg cacggcctac       480
     ctctcgaccg acctgccgaa gaagctcgcc cgctaccacg acagcgccga ttccgccttc       540
     tggggctgga accgcatctg gctgcatccg ccctttcgcg actggaacat cgaggccgag       600
     ctcgacgcca tccgctgccc ggtgctcgcc atccagggca tcgacgacga gtacggaacg       660
     ctcgcgcaga tccgcgggat tgccgcgcgc gtcggcggcg gttgcgaact ggtggaaatc       720
     cctgaatgcg ggcattcccc acatcgcgat cagccggaac gtgtcaccgt cgctaccgct       780
     tctttcatca ccaaaaacag gagacagaca ccatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page