(data stored in ACNUC1104 zone)

EMBL: CP002417.PE103

CP002417.PE103       Location/Qualifiers
FT   CDS_pept        complement(104751..105224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34326"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0091"
FT                   /protein_id="ADU34326.1"
FT                   /translation="MASKEAFHQLIAGLTAEIAGRPLDAQLDQWLNATHGAGSASFEQL
FT                   RQACIGGVAEGWLCEREGGGIKYGRVFKAEDALHRFSVDVVDMQDIAGPHHTHPNGEID
FT                   LIMPLADSAAATFDGRPAGWCVYGPGTAHRPTVAQGRALVLYLLPEGQIKFTQ"
     atggccagca aggaagcatt tcaccagttg atcgccggcc tgaccgccga aatcgccggc        60
     cggccgctcg acgcccaact cgaccaatgg ctcaacgcca cccacggcgc aggcagcgcc       120
     agcttcgaac aactgcgcca ggcctgcatc ggcggcgtcg ccgaaggctg gctctgcgag       180
     cgcgaaggcg gcggcatcaa atatggccgc gtcttcaagg ccgaagacgc gctgcaccgc       240
     ttctcggtcg acgtggtcga catgcaggac atcgccggcc cgcaccacac gcatcccaac       300
     ggcgagatcg acctgatcat gccgctggcc gacagcgccg ccgccacctt cgacggacgg       360
     cccgcgggct ggtgcgtcta cgggcccggc accgcgcacc gcccgaccgt cgcgcaaggc       420
     cgcgcgctcg tcctttatct cctgcccgaa gggcagatca agttcacgca atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page