(data stored in ACNUC1104 zone)

EMBL: CP002417.PE104

CP002417.PE104       Location/Qualifiers
FT   CDS_pept        105421..106359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0105"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; helix-turn-helix domain
FT                   protein; KEGG: vap:Vapar_0092 anaerobic benzoate catabolism
FT                   transcriptional regulator; SMART: helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34327"
FT                   /db_xref="GOA:E6UYZ8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ8"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADU34327.1"
FT                   /translation="MNEHVDAVLATAPESGTNAAPAGEAKNPLLAALGDRVRNLRAQRG
FT                   LTRKAVAVAADVSERHLANLEYGIGNASILVLQQVAGALHCSLAELVGDITTSSPEWLL
FT                   IRELLENRSEADLRRVRVALGELLGTASVDSARHRRIALVGLRGAGKSTLGQMLADDLD
FT                   VPFVELSREIEKLAGCSVREIHDLYGTNAYRRYERRALEEAIQIYGEVVIATPGGIVSD
FT                   PATFNELLAHCTTVWLQAAPEEHMGRVAAQGDMRPMAASKEAMDDLRRILDGRAAFYSK
FT                   ADLRVDTGGKTVQQAFEALRTAVGTVVREAA"
     atgaacgagc atgtagacgc ggtgctggcc accgcgccag aaagcggcac caacgccgcc        60
     ccggccgggg aggccaagaa cccgctgctg gccgcactgg gcgaccgtgt gcgcaacctg       120
     cgcgcgcagc gcggcctcac gcgcaaggcg gtggccgttg cggccgacgt gtcggagcga       180
     cacctggcca atctggagta cggcatcggc aacgcgtcga tcctggtgct gcagcaagtg       240
     gccggcgcgc tgcactgctc gctggccgag ctggtcggcg acatcaccac cagttccccc       300
     gagtggctct tgatccgcga actgctcgag aaccgcagcg aggccgacct gcgccgcgtg       360
     cgcgtggcgc tcggcgaact gctgggcacc gcctcggtcg actcggcgcg gcaccgccgc       420
     atcgcgctcg tggggctgcg cggcgcgggc aagtcgacgc tcgggcagat gctggccgac       480
     gacctggacg tgcccttcgt cgagttgagc cgcgagatcg agaagctcgc cggctgcagc       540
     gtgcgcgaga tccacgacct ctatggcacc aatgcctacc gccgctacga gcgccgcgcg       600
     ctcgaggagg cgatccagat ctacggcgag gtggtgatcg ccacgcccgg cggcatcgtc       660
     tccgacccgg ccaccttcaa cgaactgctg gcccactgca ccacggtgtg gctgcaggcc       720
     gcgcccgagg agcacatggg ccgcgtggcc gcgcagggcg acatgcgccc gatggcggcg       780
     agcaaggaag ccatggacga cctgcgccgc atcctggacg ggcgcgcggc cttctattcg       840
     aaggccgacc tgcgcgtgga caccggcggc aagacggtgc agcaagcctt cgaggcgctg       900
     cgcaccgcgg tcggcacggt ggtgcgcgaa gcggcctga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page