(data stored in SCRATCH zone)

EMBL: CP002417.PE109

CP002417.PE109       Location/Qualifiers
FT   CDS_pept        112444..113871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0110"
FT                   /product="benzoyl-CoA oxygenase, B subunit"
FT                   /note="TIGRFAM: benzoyl-CoA oxygenase, B subunit; KEGG:
FT                   vap:Vapar_0094 benzoyl-CoA oxygenase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34332"
FT                   /db_xref="GOA:E6UZ03"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ03"
FT                   /inference="protein motif:TFAM:TIGR03225"
FT                   /protein_id="ADU34332.1"
FT                   /translation="MSTINYSEKIPNNVNLGEDRTLQRALEGWQPNFINWWDDVGPEGS
FT                   TNHDVYLRTAVSVDPQGWAQFGHVKMRDYRWGIFLNPGDANREIHFGDHKGEKAWQDVP
FT                   GEHRANLRRIIVTQGDTEPASVEQQRHLGLTAPSMYDLRNLFQINVEEGRHLWAMVYLL
FT                   QKHFGRDGREEADALLQRTSGDENNPRILGAFNERTPDWLAFFMFTYFTDRDGKFQLSA
FT                   LAESAFDPLARTTKFMLTEEAHHMFVGESGVSRVIARTAQMMNELKTDDAQKIRAAGCI
FT                   DLGTIQRYLNFHYSVTIDLFGADQSSNAAIFYSSGLKGRYEEGKRTDDHILKGQTYKVL
FT                   EVKEGQLVEKDVPMLNALNEVLRDDFIKDSVAGVGRWNKVLEKAGIPTRLVVPHKAFNR
FT                   QIGALAGIKMSPEGRVVNEVEWAAKRDEWLPSSEDFAFVASLMGRVVEPGKFAGWISPP
FT                   VMGINRQPVDFEYVRFG"
     atgagcacga tcaactacag cgagaagatc cccaacaacg tcaacctcgg cgaagaccgc        60
     acgctgcagc gcgcgctcga aggctggcag ccgaacttca tcaactggtg ggacgacgtg       120
     ggccccgaag gctcgaccaa ccacgacgtg tacctgcgca ccgcggtgag cgtcgatccg       180
     cagggctggg cgcagttcgg ccacgtgaag atgcgcgact accgctgggg cattttcctg       240
     aacccgggcg atgccaaccg tgagatccac ttcggcgacc acaagggcga gaaggcctgg       300
     caggacgtgc ccggcgaaca ccgcgccaac ctgcgccgca tcatcgtgac gcaaggcgac       360
     accgagcccg cgtcggtcga gcagcagcgc cacctgggcc tgacggcgcc gtcgatgtac       420
     gacctgcgga acctcttcca gatcaacgtg gaagaaggcc gccacctgtg ggcgatggtc       480
     tacctgctgc agaagcactt cggccgcgat ggtcgcgaag aagccgatgc attgctgcag       540
     cggacctcgg gcgacgagaa caacccgcgc atcctgggcg ccttcaacga acgcacgccc       600
     gactggctcg cgttcttcat gttcacctac ttcaccgacc gcgacggcaa gttccagctc       660
     tcggcgctgg ccgagagcgc gttcgatccg ctcgcgcgca cgacgaagtt catgctgaca       720
     gaagaggcgc accacatgtt cgtgggcgag agcggtgtct cgcgcgtcat cgcgcgcacc       780
     gcgcagatga tgaacgaatt gaagaccgac gacgcgcaga aaatccgcgc ggcgggctgc       840
     atcgacctgg gcacgatcca gcgctacctg aacttccact acagcgtgac catcgacctg       900
     ttcggcgccg accagtcgag caacgcggcc atcttctaca gctcgggcct gaagggccgc       960
     tacgaagaag gcaagcgcac ggatgaccac atcctcaagg gccagaccta caaggtgctg      1020
     gaagtgaagg agggccagct cgtcgagaag gacgtgccga tgctcaacgc actcaacgaa      1080
     gtgctgcgcg acgacttcat caaggactcg gtggccggcg tcggccgctg gaacaaggtg      1140
     ctcgagaagg ccggcatccc gacccgcctg gttgtgccgc acaaggcctt caaccgccag      1200
     atcggcgcgc tcgccggcat caagatgtcg cccgagggcc gcgtggtgaa cgaggtcgaa      1260
     tgggccgcca agcgcgatga gtggctgccc agttccgaag acttcgcttt cgtggcatcg      1320
     ttgatgggcc gcgtggtgga gccgggcaag ttcgccggct ggatctcgcc gccggtgatg      1380
     ggcatcaatc gccagcccgt cgatttcgag tacgtgcgtt tcggctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page