(data stored in ACNUC1104 zone)

EMBL: CP002417.PE113

CP002417.PE113       Location/Qualifiers
FT   CDS_pept        116298..117206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0114"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: vap:Vapar_0099
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34336"
FT                   /db_xref="GOA:E6UZ07"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ07"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADU34336.1"
FT                   /translation="MRYDALVVGGSFAGLSAAMQLARARKNVCVVDAGAPRNRFAAAAH
FT                   GFFGQDGVPPLKMISDARAKLLAYPNVTLIEGRVASAQADGAGGFVASLDDGDRQLSAG
FT                   KLLLAFGVQDGFPDGIAGVRERWGTSVLHCPYCHGYEFSGRRLGVLIEAPHPPDHAMLI
FT                   AEWGPATLFLNGNNTVEEEARAKLQARGVTVEPGRIVALEGPAKDLSGVRLEDGRIVPV
FT                   DALFMVPRTRPSSPIAEQLGCAFDDGPAGPVIRTDAMKMTTVPGVYAAGDVAMPMHNAT
FT                   LSSADGVMAGTSMHRAMVFGA"
     atgcgctatg acgctcttgt cgtgggcggc agctttgccg gcctttccgc tgccatgcag        60
     ctcgcgcgcg cgcgcaagaa cgtgtgcgtg gtcgatgcgg gcgcgccgcg caaccgcttc       120
     gccgccgcgg cgcacggctt cttcgggcag gacggcgtgc cgccgctgaa gatgatttcc       180
     gatgcgcggg ccaagctcct ggcctatccg aacgtgaccc ttatcgaagg ccgcgtggcg       240
     agtgcgcagg ccgatggtgc gggcggcttt gtcgcatcgc tcgatgacgg cgaccggcag       300
     ctctcggccg gcaagctcct gctggccttc ggtgtgcagg acggctttcc ggacggcatc       360
     gccggtgtgc gcgaacgctg gggcaccagc gtgctgcact gtccctattg ccacggctat       420
     gaattcagcg gccgcaggct cggtgtgctg atcgaggcgc cgcacccgcc ggatcacgcg       480
     atgctgatcg ccgaatgggg gccggcgacg ctgttcctga acggcaacaa cacggtggag       540
     gaggaggcgc gcgcgaagct gcaggcacgc ggcgtgacgg tcgaacctgg ccgcatcgtc       600
     gcgctggaag ggccggcaaa ggacctgagc ggtgtgcgcc tcgaagacgg acgcatcgtg       660
     ccggtcgacg cgctgttcat ggtcccgcgc acgcgtcctt ccagccccat tgcggaacag       720
     ctgggatgcg cattcgacga cggcccggcc ggtccggtga tccgcaccga cgcgatgaag       780
     atgaccaccg tgcccggcgt gtatgccgcg ggcgatgtgg ccatgccgat gcacaacgcc       840
     acgctgtcct cggccgacgg cgtgatggcc ggcacgtcga tgcatcgggc gatggtgttt       900
     ggcgcttga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page