(data stored in ACNUC1104 zone)

EMBL: CP002417.PE114

CP002417.PE114       Location/Qualifiers
FT   CDS_pept        complement(117401..118723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0115"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG: vap:Vapar_0100
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34337"
FT                   /db_xref="GOA:E6UZ08"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ08"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADU34337.1"
FT                   /translation="MIELNHTHDVDARSWVDAANVAGSDFPIQNLPYAVFRRIGSPEPF
FT                   RGGVAIGDQVLDLAALAAGSHADGLALDAARVAALPALNDFFALGPAAWQALRHLVFAL
FT                   LRSDAPAATVDDLRKCLVPQSEVEYTVPARIGDYTDFYTSIDHALNITRLFNPEGDVTP
FT                   NFRWIPTAYHGRVSTIGVSGQRFHRPMGQTLAPGAKAPTYHACARLDYELELGVWIGEG
FT                   NAAGEPIPLERAEEHIFGICLLNDWSARDIQFWEMAPLGPFLAKNFATTISPWIVTMEA
FT                   LAPYRQAWTRPSSEPQPLDYLESKSNRESGAIDIRLEVWLESEKAREGKSGPSRLSRTS
FT                   FKHQYWSVAQMVAHHTMGGCQLNPGDLFGSGTISGPGEGEAGAIIELTRAGQSPVALAN
FT                   GEQRGFLEDGDAVLLRGWCEKPGHARIGFGESRGTVLPAKG"
     atgatcgaac tcaaccacac gcacgacgtc gacgcccgca gttgggtgga cgcggccaac        60
     gtcgcgggca gcgacttccc gatccagaac ctgccgtatg ccgtgttccg ccgcatcggc       120
     agccctgagc cgtttcgcgg cggcgtggcc atcggcgacc aagtgctcga cctggcggcg       180
     ttggctgccg gctcgcatgc cgacgggctc gcgctcgatg cagctcgcgt ggccgccctg       240
     cccgcgctga acgatttctt cgctctcggc cctgctgcgt ggcaagcgct gcgccatctg       300
     gtcttcgcgc tgctgcgaag cgatgcgccg gcagcgaccg tggacgactt gcgcaagtgc       360
     ctcgtgccgc agtccgaagt ggaatacacc gtgcccgcgc gcatcggcga ctacaccgac       420
     ttctacacat cgatcgacca tgcgttgaac atcacgcgcc tgttcaatcc cgagggtgac       480
     gtgacgccga actttcgctg gattccgacg gcctaccacg ggcgcgtctc gaccatcggt       540
     gtgagcgggc agcgctttca ccggccaatg gggcagacct tggcgcccgg tgcgaaggcg       600
     ccgacgtacc acgcgtgcgc acggctcgac tacgaactcg aactcggcgt gtggatcggc       660
     gaaggcaacg cggccggcga gccgattccg ctcgaacgcg cggaggaaca tatcttcggc       720
     atctgtttgc tcaacgattg gtccgcgcgc gacatccagt tctgggagat ggcgccgctc       780
     gggccctttc ttgcgaagaa cttcgcgacc acgatctcgc cgtggatcgt gacgatggaa       840
     gcgctcgcgc cctatcgcca ggcctggacg cggccgagca gcgagcccca gccgctcgac       900
     tacttggaga gcaaatcgaa ccgggagagc ggcgcgatcg acatccgcct ggaggtgtgg       960
     ctcgaaagcg aaaaggcgcg cgagggcaag agcggcccct cacgcctgtc gcgcacgagc      1020
     ttcaaacacc agtactggag cgtggcgcag atggtggcgc accacacgat gggcggctgc      1080
     cagctgaacc cgggcgacct gttcggcagc ggcacgatct cgggaccggg cgaaggcgaa      1140
     gccggcgcga tcatcgagct cacgcgtgcg gggcaaagcc ctgtggcgct ggcgaacggc      1200
     gagcagcgcg gcttcctgga agacggcgat gcggtgctgc tgcgcggctg gtgcgagaag      1260
     ccggggcatg cgcgcatcgg attcggcgag agccggggaa cggtgctgcc cgcgaagggc      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page