(data stored in ACNUC1104 zone)

EMBL: CP002417.PE115

CP002417.PE115       Location/Qualifiers
FT   CDS_pept        complement(118743..119549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0116"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: vap:Vapar_0101
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34338"
FT                   /db_xref="GOA:E6UZ09"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ09"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ADU34338.1"
FT                   /translation="MPRKFVDLSIFLENDVLSDPPAFAPKIQYFTHEQTYEQIEPFFPG
FT                   LKKEDLPDGEGWAVELVQLSTHNGTHLDAPYHFHSTMDKALGEKKPAIAIHDVPLEWCF
FT                   QPGVKLDFRHFADGYVVTAADVEAELKRIGHTLSPLEIVVVNTRAGKRYGSNDYVSAGA
FT                   GMGYEATMYLLERGVRLTGTDAWSWDAPFVHTAKKYGETQDASLIWEGHKAGRDIGYCH
FT                   IEKLHNLEVLPPTGFFISCFPHKIRGASAGWTRAVAIFDDALMASV"
     atgccacgca aattcgtcga cctctcgatc tttctggaga acgatgtgct ctccgacccg        60
     cccgccttcg cgccgaagat ccagtacttc acgcacgagc agacctacga gcagatcgag       120
     cccttcttcc ccggcttaaa gaaagaagac ctgcccgatg gcgaaggctg ggccgtggaa       180
     ctggtgcagc tctccacgca caacggcacg cacctggatg cgccctatca cttccactcg       240
     accatggaca aggcgctcgg cgaaaagaag cccgccatcg ccatccacga cgtgccgctc       300
     gagtggtgct tccagcccgg cgtgaagctc gactttcgcc acttcgccga tggctacgtg       360
     gtcacggctg ccgacgtgga ggccgagctg aagcgcatag gccacacgct gagcccgttg       420
     gagatcgtgg tggtcaacac acgtgcgggc aagcgctacg gcagcaacga ctacgtatcg       480
     gccggcgcag gcatgggcta cgaagcgacg atgtacttgc tggaacgcgg cgtgcgcctc       540
     accggcaccg acgcgtggag ctgggacgcg cccttcgtgc acaccgcgaa gaaatacggc       600
     gagacgcagg acgcctcatt gatctgggag ggccacaagg ccggccgcga catcggctac       660
     tgccacatcg agaagctgca caacctggaa gtgctgccgc ccacgggctt cttcatcagc       720
     tgcttcccgc acaagatccg cggcgcgtcg gcgggctgga cgcgcgcagt ggcgatcttc       780
     gacgacgcgc tgatggcgtc ggtctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page