(data stored in ACNUC1104 zone)

EMBL: CP002417.PE116

CP002417.PE116       Location/Qualifiers
FT   CDS_pept        complement(119618..120409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0117"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0102
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34339"
FT                   /db_xref="GOA:E6UZ10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ10"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34339.1"
FT                   /translation="MNSNDRAPSSLNWLGSFAVLCALIALWWVASNAGWVSRVFLPTPQ
FT                   ATFASLLEGLNLSGGSGNGELLAFTQATVGRMVEGWLLASLFGVVLGAAIGVSPAVRAW
FT                   IQPTLEFIRPLPASALLPLAISIFGLNPGMVLFVVAFGAMWPVLLATVHGFAAVEPRLA
FT                   EVARCLQMSRAAYIWKMGLPNAMPDILAGMRLALTIALIVAVVGEMIASQSGLGQAILL
FT                   AARAFRASDLFAGIVLLGLIGFVSNALLAFAEKRLLRWQQP"
     atgaacagca acgatcgcgc gccctcgagc ctgaactggc ttggctcgtt cgcagtgctg        60
     tgcgcgctca ttgcgctctg gtgggtcgcg agcaacgcgg gctgggtcag ccgtgtgttc       120
     ctgccgacgc cgcaggccac cttcgcgagc ctgctcgaag ggctcaacct ctccggcggt       180
     tcaggcaacg gcgaactgct ggccttcacg caagcgacgg tcggccgcat ggtcgagggc       240
     tggctgctgg cctcgctctt cggcgtggtg ctgggcgcgg ccatcggcgt gtcgcccgcg       300
     gtgcgcgcgt ggattcaacc gacgctcgaa ttcatccgtc cgctgcccgc ctcggcattg       360
     ctgccgctcg ccatttcgat cttcgggctg aaccccggca tggtgctttt cgtggtcgcg       420
     ttcggcgcga tgtggccggt gctgctggcc acggtgcacg gcttcgcggc ggtggagccg       480
     cgcctcgcgg aagtggcgcg ctgcctgcag atgtcgcgcg ccgcgtacat ctggaagatg       540
     ggattgccga atgcgatgcc cgacatcctg gccggcatgc gcctcgcgct gaccatcgcg       600
     ctcatcgtcg cagtggtggg cgaaatgatc gcctcgcaga gcggcctggg ccaagccatc       660
     ctgctggccg cgcgcgcctt ccgcgcgagc gatctgttcg ccggcatcgt gctgctcggg       720
     ctcatcggct tcgtgagcaa cgcgctgctg gcctttgcag agaagcgcct gctgcgctgg       780
     cagcaaccct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page