(data stored in ACNUC1104 zone)

EMBL: CP002417.PE117

CP002417.PE117       Location/Qualifiers
FT   CDS_pept        complement(120406..121176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0103
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34340"
FT                   /db_xref="GOA:E6UZ11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ11"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34340.1"
FT                   /translation="MTEGRLFRWLRPWVFPALLVGAFEWYARRAAALGSDALAPPSAAA
FT                   KAFAGAALDGSLWQATGFTLGTAALGLLIGAVLGIALGLVLGLSRRAAQLGSVSIEVLR
FT                   PVPSVALIPLAMLAFGFGVRMELAIVAFATFWPLLVLVQSAVQQIEPRLLEVSRVLGLS
FT                   ARERAFKIVLPAIVPRLFVALRLGVAVALVVAVTVEIAANPNGMGYAMMIAQQSFDPAL
FT                   MLAWLGWIGVVGFAVNAGMVLLQRTVARRMGVMA"
     atgactgaag gccgcctctt ccgctggctg cggccgtggg tgtttcccgc gctgctggtc        60
     ggcgccttcg agtggtatgc gcggcgcgca gcggcgctgg gcagcgatgc gctcgcgccg       120
     cccagtgcgg ccgccaaggc cttcgccggc gcggcgctcg acggttcgct ctggcaggcc       180
     accggcttca cgctcggcac cgcggcgctc ggcttgctga tcggcgcggt gctcggcatt       240
     gcgctgggcc tggtgctcgg cctctcgcgc cgtgccgcac agttgggctc ggtctccatc       300
     gaggtgctgc ggcctgttcc ctcggtcgcg ctgattccgc tcgcgatgct ggccttcggc       360
     ttcggcgtgc gcatggaact ggccatcgtt gccttcgcca ccttctggcc gctcctggtg       420
     ctggtgcagt cggcggtgca gcagatcgag ccgcgcctgc tcgaggtgag ccgcgtgctc       480
     ggcctctcgg cgcgcgagcg tgccttcaag atcgtgctgc cggccatcgt gccgcgcctc       540
     tttgtcgcgc tgcgcctggg cgtggcagtg gcgctggtgg ttgcggtgac ggtggagatc       600
     gccgccaacc ccaacggcat gggctacgcg atgatgatcg cgcagcagag cttcgacccc       660
     gcgctgatgc tcgcgtggct cggctggatc ggcgtggtgg gcttcgcggt caacgcgggc       720
     atggtgctgc tgcagcgcac ggtcgcgcgt cgcatggggg tgatggcatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page