(data stored in ACNUC1104 zone)

EMBL: CP002417.PE12

CP002417.PE12        Location/Qualifiers
FT   CDS_pept        complement(12168..13439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0012"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0012 cardiolipin synthase 2; PFAM:
FT                   phospholipase D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34235"
FT                   /db_xref="GOA:E6UXP1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34235.1"
FT                   /translation="MSHGNHWVGGNRIELLENGEEFFPRVFDAIRAAEREVIVETFILF
FT                   EDKVGLGLHAALREAAQRGAKVDLMIDGFGSPDLSREFIEGLTSVGVKVRVFDPGHRFM
FT                   GQRLNVFRRMHRKIVVVDGERAFVGGINYSADHLLDFGPKAKQDWAVELAGPIVAEIHQ
FT                   FVLRAIAVGGKGAGWFRRRLKQAPPVRQLTAGEADAMFVTRDNRRHTNDIERHYRAAIR
FT                   AARERIVIANAYFFPGYRLIKELRRAARRGVDVRLILQGEPDMPIVKTAASMLYHHLLH
FT                   AGVRIYEYCDRPLHGKVALMDDRWSTVGSSNLDPLSLSLNLEANVVVRDKAFNEVLWKR
FT                   MDQLMQESCKRIETTDLASEWSGWRLVRSFFIFHFLRWYPAWLDRLPRHVPRLTPAEAT
FT                   DLAERQKNEKNSNNTGGATPTEAA"
     atgagccacg gcaaccattg ggtcggcggg aaccgcatcg agctgctcga gaacggcgag        60
     gaattctttc cgcgcgtgtt cgatgcgatc cgcgcggcag agcgcgaagt gatcgtcgag       120
     accttcatcc tgttcgagga caaggtcggc ctcgggctgc acgcggcact gcgcgaagca       180
     gcgcagcgcg gcgccaaggt cgacctgatg atcgacggct tcggctcgcc cgacctttcg       240
     cgcgagttca tcgagggcct tacctcggtc ggtgtgaagg tgcgggtgtt cgaccccggc       300
     catcgtttca tgggacagcg gctcaacgtg ttccgccgca tgcaccgcaa gatcgtggtg       360
     gtcgacggcg aacgcgcctt cgtcggcggc atcaactatt ccgcggacca cctgctcgac       420
     ttcggtccga aggccaagca ggactgggcg gtggaactcg cgggcccgat cgtcgcggag       480
     atccaccagt tcgtgctgcg cgccatcgcc gtcggcggca agggcgcggg gtggttccgc       540
     cgccggctca agcaggcgcc gccggtgcgg caactcacgg ctggcgaagc cgacgcgatg       600
     ttcgtcacgc gcgacaaccg ccgccacacc aacgacatcg agcgccacta ccgcgccgcg       660
     atccgcgcgg cgcgcgagcg catcgtgatc gccaacgcgt atttctttcc gggctaccgg       720
     ctcatcaagg aactgcgccg cgccgcgcgc cgcggcgtcg atgtgcggct catcctgcag       780
     ggcgagcccg acatgccgat cgtgaagacg gccgcgagca tgctgtacca ccacctgctg       840
     cacgcgggcg tgcgcatcta cgagtactgc gaccggccgc tgcacggcaa ggtcgcgctg       900
     atggacgacc gctggagcac ggtcggctcg agcaatctcg atccgctgag cctgtcgctc       960
     aatctcgaag ccaacgtggt ggtgcgcgac aaggccttca acgaggtgct gtggaagcgc      1020
     atggaccagc ttatgcagga gagctgcaag cgcatcgaaa cgacagacct cgcgagcgag      1080
     tggagcggat ggcggctggt gcgcagcttc ttcatctttc acttcctgcg ttggtatccc      1140
     gcgtggctgg accgcctgcc gcgccacgtg ccgcgcctga cgccggccga ggcgaccgat      1200
     ctggccgagc ggcagaagaa cgagaagaac agcaacaaca ccggcggcgc gacgccgacg      1260
     gaagcggcat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page