(data stored in ACNUC1104 zone)

EMBL: CP002417.PE120

CP002417.PE120       Location/Qualifiers
FT   CDS_pept        complement(122967..123701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0121"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0106
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34343"
FT                   /db_xref="GOA:E6UZ14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ14"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34343.1"
FT                   /translation="MNTRTPTARRSAPRAAAITAEAGRPDRRQAILLAAEKLFAQHGYH
FT                   AVTIRQIAEEAGVPLALVGYYFGPKHELFHAIFEHWSHTIEERLTRLAEVNNDPDDACT
FT                   LPSIIEAFTTPVLALRASAEGEYYALLVARELYHATEEADRVLRGYFDPLAAAYIDALH
FT                   VALPHATRGQVAWGYQFALGALLHHLNDSRIERLSRGENKRADPAVAPMLVNFIVGGLR
FT                   AALPKPKTPRTQQKTPTRRQKT"
     atgaacaccc gcaccccgac cgcccgacgc agtgccccgc gggccgcggc gatcaccgcc        60
     gaggccggca ggcccgaccg ccgccaggcc atcctgctgg ccgccgagaa gctcttcgcg       120
     cagcacggct atcacgcggt gacgatccgg cagatcgccg aagaggccgg cgtgccgctc       180
     gcgctggtgg gctattactt cgggccgaag cacgaactct ttcacgccat cttcgagcac       240
     tggagccaca ccatcgaaga gcggctcacg cgcctcgcgg aggtgaacaa cgaccccgac       300
     gacgcctgca cgctgccgag catcatcgaa gccttcacca cgcccgtgct cgcattgcgc       360
     gcgagcgccg agggcgagta ctacgcgctg ctggtggcgc gcgagctcta tcacgcgacc       420
     gaggaagccg accgcgtgct gcgcggctac ttcgatccgc tggccgccgc atacatcgat       480
     gcgctgcacg tcgcgctgcc gcacgccacg cgcggccagg tcgcatgggg ctaccagttc       540
     gcgctcggtg cgctgctgca tcacctgaac gacagccgca tcgaacggct ctcgcgcggc       600
     gagaacaagc gcgccgaccc ggccgtggcg ccgatgctcg tgaacttcat cgtcggcggc       660
     ctgcgcgccg cgctgccgaa gcccaagacc ccgcgcacac aacagaaaac ccccacccgg       720
     agacagaaga catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page