(data stored in ACNUC1104 zone)

EMBL: CP002417.PE122

CP002417.PE122       Location/Qualifiers
FT   CDS_pept        125805..126260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34345"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ16"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0121"
FT                   /protein_id="ADU34345.1"
FT                   /translation="MSRMKRRTSLLMLSAAAGASMLSACASSTPASKPAGAASLRVSGT
FT                   VAYRERIALDPAAEVVVQLLDVSRMDAPSVTLAEQRIKANGKQVPFAYELQVDAARIDP
FT                   RMRYAVSARILRGEQLLFINDTQYPVLTQGSGTTANLVLVRVTPSPR"
     atgagccgga tgaaaagacg taccagcctc ctgatgcttt ccgccgcagc cggcgcttcg        60
     atgttgagcg cctgtgcttc ttccacaccc gcatcgaagc ccgctggcgc cgcatcgctg       120
     cgtgtgagcg gcacggtggc ctaccgcgag cgcatcgcgc tcgaccccgc ggccgaggtc       180
     gtggtccagc tgctcgatgt gtcgcgcatg gacgcacctt cggtcacgct ggccgagcag       240
     cgcatcaagg ccaacggcaa gcaggtgccc ttcgcctacg agttgcaggt cgatgccgcg       300
     cgcatcgatc cgcgcatgcg ctacgcggtg tcggcgcgca ttctgcgcgg cgagcaactg       360
     ctgttcatca acgacacgca gtacccggtg ctcacgcagg gcagcggcac caccgccaac       420
     ctcgtgctgg tgcgcgtaac gccgtcgccg cgctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page