(data stored in ACNUC1104 zone)

EMBL: CP002417.PE123

CP002417.PE123       Location/Qualifiers
FT   CDS_pept        complement(126268..128235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0124"
FT                   /product="adenylate/guanylate cyclase with integral
FT                   membrane sensor"
FT                   /note="KEGG: vap:Vapar_0108 adenylate/guanylate cyclase
FT                   with integral membrane sensor; PFAM: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; histidine kinase HAMP region
FT                   domain protein; Cache domain protein; SMART: adenylyl
FT                   cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34346"
FT                   /db_xref="GOA:E6UZ17"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ17"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ADU34346.1"
FT                   /translation="MNSSGSPDVAGKPPFESAGAHTSPPPTVGPEAPPRRSRRFRVDVG
FT                   TIVSAVALAQSLLLVSLGYWGSQRLVSNIGTSAHRAAHDRTEDKVLAFLTKAESVVGAI
FT                   GSAPSLSPAGEHSERTAELLWTLLQQSPELDSVYVANENGQMLMALRYPVPAIRHIARG
FT                   AEFTTETWQYKRPLGAELDAQQRFATQRIESFRSSYDPTRRSWFQQANKMQGPIWTQPY
FT                   VFAAAQELGVTYALPSERRYTEGSPKALVVAGDVSLGRLSEFVRLFSSNGYGHSALLSA
FT                   DHKVLARSDLPGVLHQLDAPTGVLGTLHAQMHLHMATDGTPDGNGDSTFPFDFEGKRYL
FT                   VQTSLIPSTGWELVSWVPEDMVLGDLRRAVLWGLLLALVFLALALFMSLKLSKLVTSPV
FT                   ENLSRIARRIGLLELDNLPREPSRVLEIQHLDQALDDSARSLKAFSKFVPVNVINQLVA
FT                   EGHALAPSGSARRVTVMFTDVEGFTSISESLPIDVLVGMLTEYFNLATGVFARYGGVVD
FT                   KFIGDGIMVLWGAPADMKDAEYRACLAALQLHAQMGELNSKWRARGLPEFRTRIGIHTG
FT                   VVIAGVLGSNDRLSYTAFGDVINVASRIEGINKQLGTQTLMSEDTFAGLKGRLSTRRIE
FT                   ELVELRGRQTRMVLYELMKL"
     atgaactcgt ccggatcgcc ggatgtggcg gggaagccgc cgtttgaatc cgccggtgcg        60
     cacacgtcgc cgccgccgac ggtcgggccc gaggccccac ctcggcgctc gcgccgtttc       120
     agggtcgacg tgggcaccat cgtcagcgcg gtcgccctgg cccagtcgct gctgctggtc       180
     tccctaggct attggggctc gcagcggctg gtgtcgaaca tcggcacctc cgcgcaccgg       240
     gccgcgcacg accggaccga ggacaaggtg ctcgccttcc tgacgaaggc cgagtcggtg       300
     gtcggcgcca tcggcagcgc gccgagcctg agcccggcgg gcgagcattc cgagcgcacc       360
     gccgaactgc tctggacgct gctgcagcaa tcgcccgagc tcgacagcgt gtacgtggcc       420
     aacgaaaacg gccagatgct gatggcgctg cgctacccgg tgccggcgat ccggcacatc       480
     gcgcgcggcg cggaattcac caccgaaacc tggcagtaca agcggccgct cggggcggaa       540
     ctcgatgcgc agcagcgctt tgccacgcag cgcatcgaat cctttcgcag cagctacgac       600
     ccgacgcggc gcagctggtt ccagcaggcc aacaagatgc aggggccgat atggacgcag       660
     ccctacgtgt tcgccgcggc gcaggaactg ggcgtgacct acgcgctgcc gagcgagcgg       720
     cgctacaccg agggcagccc caaggcgctg gtggtggcgg gcgacgtgtc gctcgggcgg       780
     ctgtcggagt tcgtgcggct cttcagcagc aacggctatg gccacagcgc cctgctgagc       840
     gccgaccaca aggtgctggc gcgcagcgac ttgccgggcg tgctgcacca gctggatgcg       900
     cccacgggcg tgctcggcac gctgcacgcg cagatgcacc tgcacatggc gaccgacggc       960
     acccccgacg gcaacggcga ctcgaccttc ccgttcgact tcgaaggcaa gcgctacctg      1020
     gtgcagacct cgctgatccc atccaccggc tgggagttgg tgagctgggt gcccgaggac      1080
     atggtgctgg gcgacctgcg ccgcgcggtg ctctgggggc tgctgttggc gctggtgttc      1140
     ctggcgctgg cgctgttcat gtcgctcaag ctctccaagc tggtgacctc gccggtggaa      1200
     aacctctcgc gcatcgcgcg ccgcatcggc ctgctggagc tggacaacct gccgcgcgaa      1260
     cccagccgcg tgctggagat acagcatctg gatcaggcgc tggacgactc ggcgcgcagc      1320
     ctcaaggcct tcagcaagtt cgtgccggtg aacgtgatca accagctcgt cgccgagggg      1380
     catgcgctcg cgcccagcgg ttcggcgcgg cgagtgacgg tgatgttcac cgacgtggag      1440
     ggcttcacct cgatttcgga gtcgctcccc atcgacgtgc tggtgggcat gctgaccgag      1500
     tacttcaacc tcgccaccgg tgtgttcgcg cgctacggcg gcgtggtcga caagttcatc      1560
     ggcgacggga tcatggtgct gtggggcgcg cctgccgaca tgaaggatgc ggagtaccgc      1620
     gcctgcctcg ccgcactgca gttgcatgcg cagatgggcg agctcaacag caagtggcgc      1680
     gcgcggggcc tgcccgagtt ccgcacccgc atcggcatcc acaccggcgt ggtgatcgcg      1740
     ggggtgctgg gctcgaacga ccggctgtcg tacacggcat tcggcgacgt catcaacgtg      1800
     gcgagccgca tcgagggcat caacaagcaa ctggggacgc agacgctgat gtccgaggac      1860
     accttcgcgg gactgaaggg gcggctcagc acgcgccgca tcgaggagct ggtcgagctg      1920
     cgcggccggc agacgcgcat ggtgctctac gagctgatga agctttga                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page