(data stored in SCRATCH zone)

EMBL: CP002417.PE124

CP002417.PE124       Location/Qualifiers
FT   CDS_pept        complement(128426..129172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0125"
FT                   /product="Protein of unknown function DUF2086"
FT                   /note="PFAM: Protein of unknown function DUF2086; KEGG:
FT                   vap:Vapar_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34347"
FT                   /db_xref="GOA:E6UZ18"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ18"
FT                   /inference="protein motif:PFAM:PF09859"
FT                   /protein_id="ADU34347.1"
FT                   /translation="MLAARRDTAGMTTTHPSRIDALDWPRIETDLATRGCATTGQLFTP
FT                   KECAQLAAMYDEGGHHFRSRVVMQRHGFGEGEYQYFANPLPPLITAWRSALYERLAPLA
FT                   NAWASAMGQAADYPPDHAAYLARCHAAGQLRPTPLLLRYDEGDYNCLHQDLYGDLQFPL
FT                   QLTVLLSRPGEDFTGGEFVLTEQRPRMQSRAEVVSLAQGEAVIFAVNQRPVAGTRGTYR
FT                   VTMRHGVSRLRSGRRHTVGLIFHDAR"
     atgcttgcgg cgcggcggga cactgcgggc atgacgacaa cccatccttc ccgcatcgac        60
     gcactcgact ggccgcgcat cgagaccgat ctcgccaccc gcggctgcgc caccaccggc       120
     cagctcttca cgccgaagga atgcgcccag ctcgcggcga tgtacgacga aggcggccat       180
     catttccgca gccgcgtggt catgcagcgc cacggcttcg gcgagggcga ataccagtac       240
     ttcgcgaatc cgctgccgcc gctgatcacg gcgtggcgca gcgcactcta cgaacgcctc       300
     gcgccgctcg ccaatgcctg ggcgagcgcg atgggccagg cggccgacta tccccccgat       360
     cacgccgcct acctcgcacg ctgccacgcg gcgggccaac tgcgccccac ccccttgctg       420
     ctgcgctacg acgaaggcga ctacaactgc ctgcaccagg acctgtacgg cgacctgcag       480
     tttccgctgc agctcacggt gctgctgagc cggccgggcg aggacttcac cggcggcgag       540
     ttcgtgctga ccgagcagcg cccgcgcatg cagtcgcgcg ccgaagtcgt atcgctcgcg       600
     cagggcgagg ccgtgatctt cgcggtcaac cagcgcccgg tggcgggcac gcgcggcacc       660
     taccgcgtga cgatgcgaca cggcgtgagc cgcctgcgct cggggcggcg gcacacggtg       720
     ggcctcatct ttcacgacgc gcgctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page