(data stored in ACNUC1104 zone)

EMBL: CP002417.PE125

CP002417.PE125       Location/Qualifiers
FT   CDS_pept        129312..131087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO2981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34348"
FT                   /db_xref="GOA:E6UZ19"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ19"
FT                   /inference="similar to AA sequence:KEGG:SPO2981"
FT                   /protein_id="ADU34348.1"
FT                   /translation="MPGSIFLHGIALANYRGIGSDIVRIGPFQRFNFFVGPNNSGKSTV
FT                   LNFISQHLSTHVSSPPRGSRNQPVSLRPLDKNTKTNEDVVMGIGLPMSKAREQLEHIFN
FT                   EEPYDWHSHMNAIEYLLEFFQEENILWFQRGADPSKPLAPIPLNRLPSVEEITNASRVN
FT                   IKGLWSRLTRQSGGGPNLWVGESINRLLSLIDISLPAVALIPAIRQISERGQDFSDWSG
FT                   KGLIEELARHQNPDYSERLKIEKFEAVNSFVRVVTANSSARIEIPYDRQHILVHMDDKV
FT                   LPLHALGTGIHEVIMLAAFCTLLEQQIVCIEEPEIHLHPLLQRRLVQYLADQTSNQYFV
FT                   ATHSASIIDATEAAVFHVSNKSATTKIEPALTSAAKFQVCRDLGYRASDILQTNAIVWV
FT                   EGPSDRIYLNHWIVARDSTLREGTDYSIMFYGGRLLSHLAATDDVEVGDIEKDLEALIE
FT                   VRRLNRHLCVVIDSDKSSKDSPINSTKRRVIAELHRHGGIGWVTEGREIENYVEKEEMS
FT                   IALREVYGERFGRRLKSGQFEHVLPFVKADGKIFKEVDKVAVARATCKKPANLDILDLK
FT                   MRVEEIVAFIHEARE"
     atgcccggat ctatttttct gcatggaatt gcacttgcca actatcgagg gattggcagc        60
     gacatcgtcc gaataggacc atttcaaaga tttaacttct ttgtaggtcc caataattcg       120
     ggtaaatcga ccgttctgaa cttcatttcg cagcatttga gtacgcatgt cagttcaccc       180
     ccgcggggat ccagaaatca acctgtaagt ttgcggccat tagataaaaa cacaaaaact       240
     aatgaggatg tggtcatggg cattggcctt cctatgtcga aggcgcgcga gcaacttgag       300
     catattttta atgaagagcc ttatgactgg cactcgcaca tgaatgccat cgaatatttg       360
     ttggagttct ttcaggagga aaatattctg tggtttcagc gtggcgcaga tccgagcaag       420
     ccgttggcgc ctataccttt aaatcgcctc ccctccgttg aagagataac aaatgctagt       480
     cgagtgaata tcaaaggatt gtggtcaaga ctgacgaggc agagtggtgg gggcccaaat       540
     ctttgggttg gcgaatcaat caatcgattg ctttcgttga tcgacatttc tcttcctgca       600
     gttgctttaa taccggcaat taggcaaata tctgagagag ggcaagattt ttcagactgg       660
     tctggcaaag ggttaattga agagcttgcg aggcatcaaa acccagatta ttccgagcgc       720
     ttgaaaatag aaaaattcga ggcggtgaat agctttgtca gagtggtaac cgccaattca       780
     tcggcaagaa ttgagattcc gtatgatcgg cagcacattt tggttcatat ggatgacaaa       840
     gttcttcctc ttcatgcgtt aggaacaggg attcacgaag tcatcatgtt ggctgccttt       900
     tgcactctac ttgagcagca aattgtgtgc atagaggagc ctgaaattca tttgcatcct       960
     ctcctgcaac gacggttggt gcagtacctt gcagatcaaa cttcaaatca atatttcgtg      1020
     gcaacgcact ctgcgagcat catcgatgca accgaggccg cggtgttcca tgtatccaat      1080
     aaatcggcga caactaaaat cgagcctgca ttgacttctg cagcaaaatt tcaggtttgt      1140
     cgggacttgg gatatcgagc atcagatatc ttgcaaacca atgcgattgt ttgggttgag      1200
     ggaccatcgg atcggattta tttgaatcat tggatagttg caagggattc aacactgcgt      1260
     gaaggcacgg attactcaat tatgttttat ggagggcgct tgctaagtca tctagccgca      1320
     acggatgatg ttgaagtcgg cgatattgaa aaagatcttg aagcattgat tgaggttcgc      1380
     cggttgaata gacatctttg tgtggtaatt gatagtgaca aatccagcaa agattctcca      1440
     attaattcta cgaagagacg agtcattgcc gagttgcatc ggcacggcgg aattggctgg      1500
     gtcaccgagg gtcgagaaat cgaaaattat gtggaaaaag aagagatgag tattgccttg      1560
     cgcgaagttt atggagaacg ttttggtcgc cgcctcaaga gcgggcaatt tgagcacgtt      1620
     ctcccatttg tgaaagcaga tggaaaaata ttcaaggaag tggataaggt ggcggtggct      1680
     cgtgcaacct gcaaaaaacc agcgaacttg gatatccttg atctcaaaat gcgcgtagag      1740
     gaaatcgtcg cattcataca tgaggcgcgc gaatag                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page