(data stored in ACNUC1104 zone)

EMBL: CP002417.PE128

CP002417.PE128       Location/Qualifiers
FT   CDS_pept        complement(132655..133557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0129"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0117 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34351"
FT                   /db_xref="GOA:E6UZ22"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ22"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34351.1"
FT                   /translation="MRRKIPPLQTLVCFDAAARHESYTRAAQELALTQSAVSRQIGTLE
FT                   AFLGVALFRRTRHGVALTASGAAYARQITKRLEAMERDTLDAMAHQGEGGSLSLAAVPT
FT                   FATRWLMPRLKGFAALQPDVVVHIETRTRPFLFADAEFDAALYAGTPAQVENWAGTRAL
FT                   LLMHEDVVPVCSPSLLPRGKAVAPAVISKMPLLQQSTRPDGWRQWFDAQQIDAPNARGG
FT                   PRYELFSILAAAASHGLGVALMPTMLVADELARGELVVACARPLSGERNYYLVTPERAD
FT                   QRPLLKFFSDWLLEQARQG"
     atgcgccgca agatcccacc cctgcaaacc ctcgtgtgct tcgacgccgc cgcgcgccac        60
     gagagctaca cgcgcgccgc ccaggaactc gcgctcaccc agagcgcggt gtcgcggcag       120
     atcggcacgc tggaagcctt cctcggcgtc gcgctctttc gccgcacgcg gcacggcgtg       180
     gcactcacgg ccagcggcgc agcctatgcg cggcagatca ccaagcggct cgaagcgatg       240
     gagcgcgaca cgctcgacgc catggcgcac cagggcgaag gcggctcgct gtcgctggcg       300
     gccgtgccca ccttcgccac gcgctggctg atgccgcgcc tgaagggttt cgccgcgctg       360
     cagcccgacg tggtggtgca catcgagacg cgcacccgtc cctttctttt tgccgacgcg       420
     gagttcgacg cggccctcta cgccggcacg cccgcgcagg tcgagaactg ggccggcacg       480
     cgcgcgctgt tgctgatgca cgaggacgtg gtgccggtgt gcagcccttc ccttctccct       540
     cgcggcaagg ccgtggcacc ggcggtcatt tcgaagatgc cgctgctgca gcagagcacg       600
     cggcccgacg gctggcgcca gtggttcgac gcgcagcaga tcgacgcgcc caacgcgcgc       660
     ggcggtccgc gctacgagct gttctcgatc ctcgccgcgg ccgcctcgca cggcctgggc       720
     gtggcgctga tgcccacgat gctggttgcc gacgaactgg cgcgcggcga actggtggtg       780
     gcgtgcgcac ggccgctatc aggtgagcgc aactactacc tcgtgacgcc ggagcgcgcc       840
     gaccagcggc cgctgctcaa gttcttcagc gactggttgc tggagcaggc gcgccaaggt       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page