(data stored in SCRATCH zone)

EMBL: CP002417.PE13

CP002417.PE13        Location/Qualifiers
FT   CDS_pept        complement(13453..14241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0013"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   vap:Vapar_0013 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34236"
FT                   /db_xref="GOA:E6UXP2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP2"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADU34236.1"
FT                   /translation="MSSSPIPTVAAAPAPTSLKVMTVNTHKGFTALNRKFILPELRDAV
FT                   RTVGADVVFLQEVLGTHSRHSRKVSNWPDAPHYEFLADTMWPQFAYGRNAVYPKGHHGN
FT                   AVLSKFPIVHFRNHDVSVSGPEKRGLLHCVLRLPGRTVDVHVICAHLGLAEAHRQQQLE
FT                   LLCHIVRDEVPADAPLIVAGDFNDWRGRAHEVLEKGADLREVFVHANGRAARTFPSRFP
FT                   LLPLDRIYVRNAGVHAPVVLPRRPWSHLSDHAPLVADIDL"
     atgtcttcct ccccgatacc aaccgtggcc gccgcgcccg caccgacctc gctgaaggtc        60
     atgacggtga acacccacaa gggcttcacc gcgctcaacc gcaagttcat ccttcccgaa       120
     ttgcgcgacg cggtgcgcac ggtcggcgcc gacgtggtct tcctgcagga agtgctgggc       180
     acgcattcgc gccattcgcg caaggtgagc aattggccgg atgcgccgca ctacgaattc       240
     ctggccgaca ccatgtggcc gcagttcgcc tatggccgca acgccgtgta cccgaagggc       300
     caccacggca acgcggtgct gtcgaagttt ccgatcgtgc atttccgcaa ccacgatgtg       360
     tcggtgagcg gccccgagaa gcgcggcctc ctgcactgcg tgctgcgcct gccgggccgc       420
     acggtcgacg tgcatgtgat ctgcgcgcac ctggggctgg ccgaagcgca tcgccagcag       480
     cagctcgaac tgctctgcca catcgtgcgc gacgaagtgc cggccgatgc gccgctgatc       540
     gtcgcgggcg acttcaacga ctggcgcggc cgcgcgcacg aggtgctgga aaaaggcgct       600
     gacttgcgcg aggtgttcgt gcatgcgaat ggtcgcgccg ccaggacctt tccctcgcgt       660
     tttcccctgc tgccgctgga ccgcatctat gtgcgcaacg ccggcgtgca cgcgccggtg       720
     gtgctgccgc gccggccttg gtcgcacctg tcggaccacg cgccgctggt agcggacatc       780
     gatctttga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page