(data stored in SCRATCH zone)

EMBL: CP002417.PE135

CP002417.PE135       Location/Qualifiers
FT   CDS_pept        138510..139340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34358"
FT                   /db_xref="GOA:E6UZ29"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ29"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0122"
FT                   /protein_id="ADU34358.1"
FT                   /translation="MTRTVAQKRADFRALHEQGCFVIPNPWDTGSARYLQGLGFKALAT
FT                   TSSGHAWSQGFADGAQSRDTVLAHLRDIVAATDLPVNADFENGFASDAQGVAESVRLAV
FT                   ETGVAGLSIEDSTGDATNPLFPIDVAVERLRAARRAIDAAGGDTLLVGRAENFFAGRPD
FT                   LDDTIARLKAYAEAGADCLYAPGIKTREQIAAVVAAVAPKPVNLLVGGVSDLTMKDIAE
FT                   LGVRRVSVGGGLARAAWGGFDRAARALAEHGRFDGFEGAAAGADLNGFFGRFSS"
     atgacccgca ccgtcgccca gaaacgcgcc gacttccgcg cgctccacga acagggctgc        60
     ttcgtcatcc ccaacccctg ggacaccggc agcgcgcgct acctgcaggg cctgggcttc       120
     aaggcactgg ctacaacgag ctcgggccat gcgtggtcgc agggctttgc cgatggggcg       180
     caatcgcgcg acaccgtgct cgcgcacctg cgcgacatcg tggcggcgac cgacctgccg       240
     gtgaacgcgg acttcgagaa cggcttcgca tccgacgcgc aaggcgtggc cgaaagcgtg       300
     cggctcgcgg tcgagaccgg cgtggcgggt ttgtcgatcg aagactcgac gggcgacgca       360
     acgaatccgc tctttcccat cgacgttgcg gtcgagcgcc tgcgcgccgc gcgccgggcc       420
     atcgatgcgg cgggtggcga caccttgctc gtcggccgtg ccgagaactt cttcgcgggc       480
     cggcccgacc tggacgacac catcgcgcgg ctcaaggcct atgcggaggc cggagccgat       540
     tgcctctatg cgcccggcat caagacgcgc gagcagatcg ccgccgtggt cgcggccgtg       600
     gcaccgaagc ccgtcaacct gctggtcggc ggggtgagcg atctcacgat gaaggacatt       660
     gccgaactcg gcgtgcggcg ggtcagcgtg ggcggtgggc tcgcgcgcgc ggcatggggc       720
     ggcttcgatc gcgccgcgcg cgcgcttgcc gaacacggac gcttcgacgg cttcgagggg       780
     gccgccgcgg gtgcggatct caatgggttc ttcggccgtt tttccagtta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page