(data stored in ACNUC1104 zone)

EMBL: CP002417.PE136

CP002417.PE136       Location/Qualifiers
FT   CDS_pept        139357..139935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0137"
FT                   /product="uracil-DNA glycosylase superfamily"
FT                   /note="KEGG: vap:Vapar_0123 uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34359"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ30"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0123"
FT                   /protein_id="ADU34359.1"
FT                   /translation="MDALLTEIRDCRACAAHLPLGPRPVVQTSATARLLLVGQAPSVTV
FT                   HTTGVPWNDKSGEQLRRWLGIDREVFYDATRVALMPMGFCYPGRGTSGDLPPRRECAEL
FT                   WQARLLAEMKQVELTLLIGQYAQRHFLGAARKAGVTETVEAFAEYGPRFIPLPHPSPRN
FT                   TGWFKHHPWFESDVLPVLRERVRQALAQR"
     atggacgcgc tgctcacgga aatccgcgat tgccgcgcct gtgccgcgca cctgccgctc        60
     gggccgcgtc ccgtcgtgca gaccagcgcc acggcgcgcc tgctgctcgt cggccaggcg       120
     ccgagcgtga cggtgcacac caccggcgtg ccatggaacg acaagagcgg tgagcagctg       180
     cgccgctggc tcggcatcga ccgcgaagtg ttctacgacg ccacgcgcgt cgcgctcatg       240
     ccgatgggtt tctgctaccc cggccgcggc accagcggcg acctgccgcc gcgcagggag       300
     tgcgccgagc tctggcaggc gcggctgctc gcagagatga agcaggtcga gctcacgctg       360
     ctgatcggcc agtacgcgca gcgccacttc ctgggcgcgg cccgcaaggc cggcgtgacc       420
     gaaaccgtcg aggcctttgc ggaatacggg ccccgcttca ttccgctgcc gcatccgtcg       480
     ccgcgcaaca ccggctggtt caagcaccac ccgtggttcg aaagcgatgt gctgccggtg       540
     ctgcgcgagc gcgtgcggca ggcgctcgcg cagcgctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page