(data stored in ACNUC1104 zone)

EMBL: CP002417.PE141

CP002417.PE141       Location/Qualifiers
FT   CDS_pept        complement(144093..144593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34364"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ35"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0136"
FT                   /protein_id="ADU34364.1"
FT                   /translation="MTEPIDSANPDTPALQQDRFWQDRGWTARIIKNEEDDGWAVEMTR
FT                   DGDPEPALVGPWTMGRDKKNPKPMDGPAFSTLVKTAAEVIRRHEQQLHATLNKSVTVTA
FT                   RDGRRIRVALAIVPDEDNPSATLSAHDDEDDSELASVNVSPAFKLTSGSATSWIEADFA
FT                   RPR"
     atgaccgaac ccatcgactc cgcaaacccc gacacccccg ccctccagca agaccgcttc        60
     tggcaagaca gaggctggac cgcccgcatc atcaagaacg aggaagacga cggctgggcc       120
     gtcgaaatga cccgcgacgg cgaccccgag cccgcgctgg tcggcccctg gaccatgggc       180
     cgcgacaaga agaatcccaa gcccatggac ggccccgcgt tctccacgct ggtgaagacc       240
     gccgccgagg tgatccgccg ccacgagcag cagctgcacg ccacgctcaa caagagcgtg       300
     accgtgacgg cgcgcgacgg acggcgcatt cgcgtggcgc tggccatcgt gcccgacgag       360
     gacaacccct cggccacgct gagcgcacac gacgacgaag acgacagcga gctggcgagc       420
     gtgaatgtct cgccggcctt caagctcact tccggcagcg ccaccagctg gatcgaggcc       480
     gacttcgccc gcccgcgctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page