(data stored in ACNUC1104 zone)

EMBL: CP002417.PE143

CP002417.PE143       Location/Qualifiers
FT   CDS_pept        145639..146637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0144"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="KEGG: ctt:CtCNB1_2542 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34366"
FT                   /db_xref="GOA:E6UZ37"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ37"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_2542"
FT                   /protein_id="ADU34366.1"
FT                   /translation="MAHDNNTVLVLGATGGIGGEVTRQLRQAGWTVRALQRGMAQPVKQ
FT                   EEGITWLRGDAMDRQAVMEAAKGCSVIVHAVNPPGYRNWAQLVLPMLDNSIASAKAEGA
FT                   TIVLPGTVYNYGPDAFSGLIREDAPQKPVTRKGAIRVELERRLEAASRNGARVLIVRAG
FT                   DFFGPKAGNNWFSQGLVKAGLPVKAVSYPGNANTAHQWSYLPDVARTMVALLARRDRLE
FT                   PFARFHMAGHRDTDGTQMSNAIRNVVARRTGITPRVTAFPWWLLALASPFVTTLREMRE
FT                   MRYLWQTPVLMDNAKLVAFLGHEPHTPLEEAVEASLEGMGCLGGAPMAVTA"
     atggcacacg acaacaacac ggttctggtt ctcggcgcaa cgggcggcat cggcggcgag        60
     gtgactcggc agctccgcca ggcgggttgg acggtgcggg cacttcagcg cggcatggcg       120
     caacccgtga agcaggagga gggcatcacc tggctgcgcg gcgacgcgat ggaccggcag       180
     gccgtcatgg aagccgcaaa gggttgctcg gtcatcgtgc atgcggtcaa cccgcccggc       240
     taccgcaact gggcgcagct ggtgctgccg atgctggaca acagcatcgc ctccgcaaag       300
     gccgaaggcg cgaccatcgt gctgccgggc acggtctaca actacggtcc cgatgcgttc       360
     tccggactga ttcgcgaaga cgcgccgcag aagcccgtca cccgcaaggg cgccatccgg       420
     gtcgagctgg aacggcgcct cgaagccgcc agccgcaacg gcgcccgcgt gctgatcgtg       480
     cgcgccggcg acttcttcgg cccgaaggcc ggcaacaact ggttctcgca ggggctggtg       540
     aaggcggggc tgccggtcaa ggccgtgagc tacccaggca atgccaacac ggcgcatcaa       600
     tggtcctacc tgccggatgt cgcccgcacc atggtcgcgt tgctggcgcg gcgcgacagg       660
     ctcgaaccct ttgcgcgctt ccacatggcg ggccatcgcg acaccgacgg cacccagatg       720
     agcaacgcca ttcgcaacgt ggtggcgcgc cgcaccggca tcacgccgcg cgtgacggct       780
     ttcccgtggt ggctgctggc gctggcttcg cccttcgtca ccaccttgcg cgaaatgcgc       840
     gagatgcgct acctctggca aacaccggtg ctgatggaca acgcgaagct ggtggccttc       900
     ctcgggcacg agccccacac gccgctggaa gaggcggttg aggcgtcgct ggaaggcatg       960
     ggctgcctgg gtggagcgcc gatggcggtt acagcctaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page