(data stored in ACNUC1104 zone)

EMBL: CP002417.PE145

CP002417.PE145       Location/Qualifiers
FT   CDS_pept        complement(147685..148593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0146"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0138 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34368"
FT                   /db_xref="GOA:E6UZ39"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ39"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34368.1"
FT                   /translation="MIQRKTHLDSLAIGLLIACCAFWGLQQILIKTTVTEVPPMWQASI
FT                   RMVGATVLLWLWCASRGVPLFKRDGTLWPGLLAGALFAGEFAGIYLGLQHTSASRLTVF
FT                   LYTAPFWVSLLLPRWVPAERLRGFQWLGLFIAFSGVVLAFSEGFGHMSSSQLIGDAMGL
FT                   AAGMLWGLTTLTLRTTKLATASAEKTLFYQVAVTAAVCPVLSLALGETWSFSYSSWAWT
FT                   SIGLQTVIGAFASYLTWMWLLRHYPATQMSSFTFLTPLFALVFGVVLLKEPLTLQLMVA
FT                   LAGVALGIVLVNRRSAVQRTA"
     atgatccagc gcaagaccca cctcgactcc ctcgccatcg gccttctcat cgcgtgctgc        60
     gcgttctggg gcctgcagca gatcctcatc aagaccaccg tgaccgaagt gccgcccatg       120
     tggcaggcct cgatccgcat ggtgggcgcc accgtgctcc tgtggctgtg gtgcgcctcg       180
     cgcggcgtgc cgctgttcaa gcgcgacggc acgctgtggc ccggcctgct ggccggtgcg       240
     ctcttcgcgg gcgagttcgc cggcatctac ctcggcctgc agcacaccag cgcctcgcgg       300
     ctcaccgtgt tcctgtacac cgcgccgttc tgggtttcgc tgctgctgcc gcgctgggtg       360
     cccgccgagc gcctgcgcgg ctttcaatgg ctcgggctct tcatcgcgtt ctcgggcgtg       420
     gtgctcgcat tcagcgaagg cttcggccac atgagttcgt cgcaactcat cggcgatgcg       480
     atgggcctgg cggccggcat gctctggggc ctgaccacgc tgacgctgcg caccaccaag       540
     ctcgccaccg ccagcgcgga aaaaacgctt ttctaccagg tggcggtgac cgcggcggtg       600
     tgcccggtac tgtcgctcgc gctgggcgag acctggagct tttcgtactc cagctgggcc       660
     tggacctcga tcggcctgca gaccgtgatc ggcgcgttcg cgagttacct cacctggatg       720
     tggctgctgc ggcactaccc cgccacgcag atgtcgtcct tcacctttct cacgccgctc       780
     ttcgcactgg tgttcggcgt ggtcctgctg aaggagccgc tgacgctgca gctgatggtg       840
     gcgctcgcag gcgtcgcgct cggcatcgtg ctggtgaacc ggcgctccgc ggtgcaacgc       900
     acggcatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page