(data stored in SCRATCH zone)

EMBL: CP002417.PE146

CP002417.PE146       Location/Qualifiers
FT   CDS_pept        148841..149938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0147"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="KEGG: bge:BC1002_5269 Rieske (2Fe-2S) iron-sulfur
FT                   domain protein; manually curated; PFAM: Rieske [2Fe-2S]
FT                   iron-sulphur domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34369"
FT                   /db_xref="GOA:E6UZ40"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ40"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU34369.1"
FT                   /translation="MISPLSPATQLPVSAYFDEALLRREQDEIFNKWPRYAGHSLLVPA
FT                   LNDYCVLPHHHNGLAMVHGEQGIQLFSNVCRHRQATILQGRGNSKRLSCPMHRWTYDNS
FT                   GVLIAAPKFTELPCMQLERFQTTAWKGLHFIGKTDAINELVNLPRDVKGLLDFESSYFG
FT                   HMEVHECNFNWKTFLEFYLEDYHVASFHPGLGHFVSCDNLRWFFGANWSAQMVSFHKRL
FT                   EQPGNSEIYRAWHQAVRTYYADDLPSIGAMWLLIYPNVMIEWYPLVTVISTVFPKGTGR
FT                   CVNVVEYYHPLDLKMRPDGDAMASLAASAYLETAVEDNQIGERIHEGRFALMSRRTSEY
FT                   GPYHENLEAGMVHFHQFLRDQLNCI"
     atgatttcgc cgttgtcgcc ggcgacgcaa cttccagtca gtgcgtattt cgatgaagcg        60
     ctactcaggc gcgagcagga tgaaatattt aacaagtggc ctcgctatgc gggccactct       120
     ctactcgtgc cagcgcttaa cgattactgc gtcctacccc atcaccacaa cggtcttgcc       180
     atggtgcatg gcgaacaggg cattcaactg ttctccaatg tttgtcgtca tcggcaggcg       240
     acgattcttc aggggcgcgg aaactccaaa cgcttgtcct gcccgatgca tcgatggact       300
     tacgacaatt ccggtgttct cattgcagcc cccaaattta cagagctccc ttgcatgcaa       360
     ctggagcgct tccaaacaac ggcctggaag gggcttcact tcatagggaa aactgatgca       420
     atcaacgagt tggtcaactt gccgcgtgat gtaaaaggtc ttttggattt tgaatcaagc       480
     tactttgggc atatggaagt gcacgagtgc aacttcaact ggaagacatt tttagagttt       540
     tacctcgagg actatcacgt tgcatcattt catccaggct tgggacattt cgtatcctgt       600
     gacaatcttc gttggttctt tggtgcgaac tggagtgccc agatggtttc ctttcacaag       660
     aggcttgaac agcctgggaa tagcgagata tacagggctt ggcatcaggc ggtccgaact       720
     tactatgctg acgatttacc atcgatcggg gccatgtggc ttctgatcta cccgaatgtg       780
     atgatcgagt ggtaccccct cgtcacagta atttcgacgg tctttcccaa aggaactggc       840
     cgatgcgtaa acgtggtgga gtactaccac ccgcttgacc tgaagatgcg gcccgatgga       900
     gatgctatgg cttcattggc tgcaagtgcg tatctcgaaa ctgcggttga ggataaccaa       960
     atcggggagc gtatccatga ggggcgattc gctctgatga gtcgcagaac atcggaatac      1020
     gggccgtatc acgagaacct tgaggccgga atggtgcact tccaccaatt cttgcgtgat      1080
     cagttgaatt gcatttag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page