(data stored in SCRATCH zone)

EMBL: CP002417.PE155

CP002417.PE155       Location/Qualifiers
FT   CDS_pept        158199..159356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0156"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dia:Dtpsy_3030 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34378"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V064"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34378.1"
FT                   /translation="MTVPEQRVFLAPPTTSRRRVLTGLAATAAAGLGMPAFAQGKPIRI
FT                   GTTFDNSSVEKANGQGLFQGSSAFFNALNKAGGLNGTKVELVMADDTFKPDVAKANALA
FT                   FEKDSSVLALLHPLGTRQTSEVMDAVPGMAVVGPITGTVALRKKTAPNTFWVRVNYDQE
FT                   VEKLVTTAAVLGQTRIGLVHSNDPLGQSVLAAFKAALAKAKLEPAVIATTPNTTSMEVS
FT                   PAAEAIAKAKPQVVIIGLAGTAPVFMKALRDAGGNSSAYGLSITASALAAMGDLARGLG
FT                   FVIVVPSPYSTKFEIVRRYQADMVANGTKDFSLTSLEGYINAAVLAEGLRRAGGSPTRA
FT                   SVMAGLASIENFDLGGLKINYGRTNREGGHFVDVAVIGSRGQMLS"
     atgaccgttc ccgagcagcg cgtgttcctt gcgccgccca ccaccagccg tcgccgtgtg        60
     ctgaccggtc tggccgcaac cgccgctgcg ggcctgggca tgccggcctt cgcgcagggc       120
     aaaccgatcc gcatcgggac caccttcgac aacagcagcg tggagaaggc caacgggcag       180
     gggctcttcc agggttcgag cgcgttcttc aacgcgctga acaaggcggg cggcctcaac       240
     ggcaccaagg tcgaactggt catggccgac gacaccttca agcccgatgt ggccaaggcc       300
     aacgcgctgg ccttcgagaa ggacagctcc gtgctcgcgc tgctgcaccc gctgggcacc       360
     cgccagacct cggaggtgat ggacgccgtg cccggcatgg ccgtggtcgg cccgatcacc       420
     ggcaccgtcg cgttgcgcaa gaagaccgcg cccaacacct tctgggtgcg ggtgaactac       480
     gaccaggaag tcgaaaagct ggtgaccacg gcggccgtgc tgggccagac ccgcatcggc       540
     ctcgtgcatt cgaacgaccc gctgggccag tcggtgctgg cggcgttcaa ggcggcgctc       600
     gcgaaggcga agctggagcc ggccgtcatc gcgaccacgc ccaacaccac cagcatggaa       660
     gtgagccccg cggccgaagc catcgccaag gccaagccgc aggtcgtgat catcggcctg       720
     gccggcacag cgccggtctt catgaaggcg ctgcgcgatg ccggcggcaa cagctcggcc       780
     tacggcctgt cgatcacggc cagcgcgctg gccgccatgg gcgatctcgc acggggcctg       840
     ggcttcgtga tcgtggtgcc ctcgccgtac tcgaccaagt tcgagatcgt gcgccgctac       900
     caggccgaca tggtggccaa cggcaccaag gatttctcgc tcacgagcct ggagggctac       960
     atcaacgccg ccgtgctcgc cgagggcctg cgccgcgcgg gcggctcgcc cacgcgcgcc      1020
     tcggtgatgg cgggcctggc cagcatcgag aacttcgacc tgggcgggct gaagatcaac      1080
     tacggccgca cgaaccgcga aggcgggcac ttcgtggacg tggccgtgat cggcagccgc      1140
     gggcagatgc tgagctga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page